Entry information : EgrPrx119 (Eucgr.H00888 / Egrandis_v1_0.018602m)
Entry ID 8135
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-08 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EgrPrx119 (Eucgr.H00888 / Egrandis_v1_0.018602m)
Name (synonym) EgrPrx119 (Eucgr.H00888 / Egrandis_v1_0.018602m)
Class Class III peroxidase    [Orthogroup: Prx090]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx119
start..stop
S start..stop
EglPrx119 687 0 1..338 1..338
EcamPrx119 686 0 1..338 1..338
EguPrx119 677 0 1..338 1..338
EglPrx118 613 0 1..338 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11027739..11027981 243 N° 2 11028445..11029218 774  
join(11027739..11027981,11028445..11029218)


exon

Literature and cross-references EgrPrx119 (Eucgr.H00888 / Egrandis_v1_0.018602m)
DNA ref. Phytozome 12:   scaffold_8 (11027739..11029218)
Protein sequence: EgrPrx119 (Eucgr.H00888 / Egrandis_v1_0.018602m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (312)
PWM (Da):   %s   36412.78 (33649.4)  
PI (pH):   %s   9.85 (9.85) Peptide Signal:   %s   cut: 27 range:27-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVASMFRGLAWAFILVLADSVASAAATKPCPTSSKFTVRFYKYTCPAAESIIKQTVYGAIAKNPGMAAGLLRLHFHDCFVRGCDASVLLKSTPKNPAERDHPANNPSLRGFEIIDQAKARLEAVCPKTVSCADIVAFAARDSIFKTGGIYYDVPAGRRDGRISRLPEVTQNLPPPNFNAQQLIANFARKGLSADEMVTLSGAHSIGISHCSSFSSRLYAFNTTLAQDPTLDPAFASLLKTKCPPPSNATRADPTVPLDSITPNALDNKYYLQLQKLRGVLATDETLYKSPSTSRMVVSNAVNGAAWRVKFAKAMVKMGSLDVLTGKQGEIRKVCSVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCTTCGATGTTCCGGGGTCTCGCATGGGCTTTTATCCTAGTTCTAGCTGACAGCGTCGCGTCTGCGGCGGCTACGAAGCCGTGCCCGACATCATCCAAGTTCACGGTCAGGTTC
TACAAGTACACCTGTCCAGCTGCGGAGTCTATCATCAAGCAGACTGTGTATGGAGCCATCGCCAAAAATCCGGGAATGGCGGCCGGACTCCTCCGCCTACATTTCCACGATTGCTTTGTT
AGG
GTACGTGAAGCATCTTTAGCTCCTTTTGACAAGTCCTTTAATTTATAAGCTCGTTTCACTATACATATACGTGTGCATGGCCGTCCGCAAACGGACTTCATGACACATAATACTTTG
TCAATCACTGTCCATTGAAAGTTACAGAATTGGTCAACGCCTCATGGTTGACACGATTGAATGGAGCATAAGTGTATTTTCATGTTAAAAGTTACATACCAACTGCACCGGATCGGGTCA
TCTGTATAGGCCAAAAGTTGGACTTTAACAAGGTCATTGAGGTTGTAGGGTATTCCGTGCGCTTCAAAGATGGCAAGGCCTCTAAACTCATGCCCTTAGATTATAAAATGAAAGTCACAT
AATCAAATACAAGACTTTGTTGAGTAAATTTTACCTGCAAAGTTCTTAAAATAAGACATTTGGTATGGCATATTGTTTCTCTTTCTAACCATTGAATTTTGATTAGGGTTGCGATGCGTC
GGTGCTCTTGAAATCGACTCCTAAAAACCCGGCGGAAAGAGACCATCCGGCCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGATCAGGCTAAGGCCCGACTCGAGGCTGTGTGTCC
CAAGACGGTCTCGTGTGCCGATATCGTCGCTTTTGCGGCCCGCGACAGCATTTTCAAAACCGGGGGCATATACTATGACGTCCCCGCCGGACGCCGTGACGGCCGCATCTCTCGCCTTCC
CGAAGTGACCCAAAACCTCCCGCCACCAAACTTCAACGCCCAACAGTTGATCGCTAATTTCGCCAGGAAAGGGCTGTCGGCGGATGAGATGGTGACCCTCTCGGGAGCGCACTCCATCGG
CATCTCGCACTGCTCGTCCTTCTCGTCCAGGCTCTACGCGTTCAACACCACGCTCGCCCAAGATCCTACGTTGGATCCGGCGTTTGCCTCCTTGTTGAAGACCAAATGCCCACCCCCAAG
CAACGCGACACGAGCAGACCCGACGGTGCCGCTCGACAGCATCACGCCCAACGCTCTGGACAACAAGTACTACCTCCAGCTGCAGAAGCTCCGCGGCGTGTTGGCTACGGATGAGACGCT
GTACAAGAGTCCCTCGACTTCCCGGATGGTCGTGAGCAACGCAGTGAACGGCGCTGCCTGGAGGGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGCTCGACGTGCTCACCGGCAA
ACAGGGAGAGATCAGGAAGGTGTGCAGCGTGGTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGGCTTCGATGTTCCGGGGTCTCGCATGGGCTTTTATCCTAGTTCTAGCTGACAGCGTCGCGTCTGCGGCGGCTACGAAGCCGTGCCCGACATCATCCAAGTTCACGGTCAGGTTC
TACAAGTACACCTGTCCAGCTGCGGAGTCTATCATCAAGCAGACTGTGTATGGAGCCATCGCCAAAAATCCGGGAATGGCGGCCGGACTCCTCCGCCTACATTTCCACGATTGCTTTGTT
AGG
GGTTGCGATGCGTCGGTGCTCTTGAAATCGACTCCTAAAAACCCGGCGGAAAGAGACCATCCGGCCAATAACCCTAGCTTGAGAGGCTTCGAGATCATCGATCAGGCTAAGGCCCGA
CTCGAGGCTGTGTGTCCCAAGACGGTCTCGTGTGCCGATATCGTCGCTTTTGCGGCCCGCGACAGCATTTTCAAAACCGGGGGCATATACTATGACGTCCCCGCCGGACGCCGTGACGGC
CGCATCTCTCGCCTTCCCGAAGTGACCCAAAACCTCCCGCCACCAAACTTCAACGCCCAACAGTTGATCGCTAATTTCGCCAGGAAAGGGCTGTCGGCGGATGAGATGGTGACCCTCTCG
GGAGCGCACTCCATCGGCATCTCGCACTGCTCGTCCTTCTCGTCCAGGCTCTACGCGTTCAACACCACGCTCGCCCAAGATCCTACGTTGGATCCGGCGTTTGCCTCCTTGTTGAAGACC
AAATGCCCACCCCCAAGCAACGCGACACGAGCAGACCCGACGGTGCCGCTCGACAGCATCACGCCCAACGCTCTGGACAACAAGTACTACCTCCAGCTGCAGAAGCTCCGCGGCGTGTTG
GCTACGGATGAGACGCTGTACAAGAGTCCCTCGACTTCCCGGATGGTCGTGAGCAACGCAGTGAACGGCGCTGCCTGGAGGGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGCTC
GACGTGCTCACCGGCAAACAGGGAGAGATCAGGAAGGTGTGCAGCGTGGTGAACTGA

Retrieve as FASTA