Entry information : EgrPrx121 (Eucgr.H00890 / Egrandis_v1_0.049807m)
Entry ID 8136
Creation 2011-02-04 (Christophe Dunand)
Last sequence changes 2011-02-10 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: EgrPrx121 (Eucgr.H00890 / Egrandis_v1_0.049807m)
Name (synonym) EgrPrx121 (Eucgr.H00890 / Egrandis_v1_0.049807m)
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx121
start..stop
S start..stop
EglPrx121 679 0 1..333 1..333
EcamPrx121 677 0 1..333 1..333
EguPrx121 674 0 1..333 1..333
EcamPrx122 552 0 1..333 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11061176..11061403 228 N° 2 11060170..11060943 774  
complement(join(11060170..11060943,11061176..11061403))


exon

Literature and cross-references EgrPrx121 (Eucgr.H00890 / Egrandis_v1_0.049807m)
DNA ref. Phytozome 12:   scaffold_8 (11061403..11060170)
Protein sequence: EgrPrx121 (Eucgr.H00890 / Egrandis_v1_0.049807m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (310)
PWM (Da):   %s   36071.51 (33620.2) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.86 (9.76) Peptide Signal:   %s   cut: 24 range:24-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASITAGFRALALVLFVSVFATAARSPNSSLKVGYYRRTCPSTEAIVRKTVFEAVSRNPGMAAGLIRMHFHDCFVRGCDASVLLKSTAGNPAERDHPANNPSLRGFEIIDQAKAQLEALCPRTVSCADIVAFAARDSAYKARGIYYDVAAGRRDGRISRLPEVTQNLPPPSFNAQQLIANFARKGLSADEMVTLSGAHSIGISHCSSFSSRLYTFNATLAQDPSLDPAYAAFLKRKCPPPSNVTQADPTVPLDSITANTLDNKYYLQLLKLRGLLTSDETLYTSPSTSRMVVNNAKNNFAWSVKFAKAMVKMGSIDVLTGKQGEIRKLCSIVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (5' end is missing which has been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATCACAGCAGGATTTCGTGCGCTCGCGCTGGTTCTCTTCGTCTCGGTTTTTGCAACAGCAGCTCGAAGTCCGAACTCGTCCCTAAAGGTGGGATACTACCGACGTACTTGC
CCGTCGACAGAAGCTATTGTCAGGAAAACCGTGTTTGAGGCCGTCTCTAGGAACCCCGGGATGGCAGCTGGTCTCATTCGCATGCATTTTCATGATTGCTTCGTTAGG
GTACGGCGAAGT
ATTTATGCTCAGTAGTTTCGCCTTGATCAACTTATTTCTCCTTCCTTGAACTTTTCATTAATCCCCTTTTCTACCTAGTTGCGATTTAAGAGAAAGACAATGATGATAATGTGTGCTAAG
AGCATTTGCTAAGACTCATATAATAAATATTGGAAATGTAAGCTTTATATTACGAGGCAAATGGTTTCTTTCAGTTACTAACTCATTCGCCTTATCTCAGGGCTGTGATGCTTCAGTGCT
CTTGAAATCAACCGCAGGAAACCCGGCGGAAAGAGATCACCCCGCGAACAACCCGAGCCTACGAGGGTTTGAAATCATCGATCAGGCCAAGGCCCAGCTCGAAGCCTTGTGCCCCAGGAC
CGTCTCATGTGCCGATATAGTTGCTTTTGCCGCCCGTGACAGTGCCTACAAGGCTAGGGGCATATACTACGATGTCGCTGCTGGCCGCCGCGACGGCCGTATCTCTCGCCTCCCGGAAGT
TACACAGAACCTCCCGCCACCAAGCTTCAACGCCCAACAGCTCATTGCCAACTTCGCTAGGAAAGGGCTTTCGGCGGATGAGATGGTGACCCTGTCAGGAGCACACTCGATTGGAATCTC
CCACTGCTCTTCCTTCTCAAGCCGCCTCTACACGTTCAACGCCACACTCGCCCAAGATCCTTCCTTGGACCCTGCGTACGCTGCATTCTTGAAGAGAAAGTGCCCACCACCGAGCAATGT
GACGCAAGCAGACCCGACCGTGCCACTTGATAGCATCACAGCCAACACTTTGGACAACAAGTACTACCTCCAGTTGCTGAAGCTCCGTGGCTTGTTGACTTCTGACGAGACGCTGTACAC
GAGTCCCTCGACTTCAAGGATGGTCGTGAACAATGCGAAGAACAACTTCGCTTGGAGCGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGATCGACGTACTCACTGGTAAACAAGG
AGAGATCAGGAAGCTGTGCAGTATTGTAAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATCACAGCAGGATTTCGTGCGCTCGCGCTGGTTCTCTTCGTCTCGGTTTTTGCAACAGCAGCTCGAAGTCCGAACTCGTCCCTAAAGGTGGGATACTACCGACGTACTTGC
CCGTCGACAGAAGCTATTGTCAGGAAAACCGTGTTTGAGGCCGTCTCTAGGAACCCCGGGATGGCAGCTGGTCTCATTCGCATGCATTTTCATGATTGCTTCGTTAGG
GGCTGTGATGCT
TCAGTGCTCTTGAAATCAACCGCAGGAAACCCGGCGGAAAGAGATCACCCCGCGAACAACCCGAGCCTACGAGGGTTTGAAATCATCGATCAGGCCAAGGCCCAGCTCGAAGCCTTGTGC
CCCAGGACCGTCTCATGTGCCGATATAGTTGCTTTTGCCGCCCGTGACAGTGCCTACAAGGCTAGGGGCATATACTACGATGTCGCTGCTGGCCGCCGCGACGGCCGTATCTCTCGCCTC
CCGGAAGTTACACAGAACCTCCCGCCACCAAGCTTCAACGCCCAACAGCTCATTGCCAACTTCGCTAGGAAAGGGCTTTCGGCGGATGAGATGGTGACCCTGTCAGGAGCACACTCGATT
GGAATCTCCCACTGCTCTTCCTTCTCAAGCCGCCTCTACACGTTCAACGCCACACTCGCCCAAGATCCTTCCTTGGACCCTGCGTACGCTGCATTCTTGAAGAGAAAGTGCCCACCACCG
AGCAATGTGACGCAAGCAGACCCGACCGTGCCACTTGATAGCATCACAGCCAACACTTTGGACAACAAGTACTACCTCCAGTTGCTGAAGCTCCGTGGCTTGTTGACTTCTGACGAGACG
CTGTACACGAGTCCCTCGACTTCAAGGATGGTCGTGAACAATGCGAAGAACAACTTCGCTTGGAGCGTGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGATCGACGTACTCACTGGT
AAACAAGGAGAGATCAGGAAGCTGTGCAGTATTGTAAATTGA

Retrieve as FASTA