Entry information : EgrPrx[P]143 ( Eucgr.I02714 / Egrandis_v1_0.050432m)
Entry ID 8139
Creation 2011-02-09 (Christophe Dunand)
Last sequence changes 2012-01-24 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EgrPrx[P]143 ( Eucgr.I02714 / Egrandis_v1_0.050432m)
Name (synonym) EgrPrx[P]143 ( Eucgr.I02714 / Egrandis_v1_0.050432m)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]143
start..stop
S start..stop
EguPrx[P]143 214 2e-73 1..120 1..120
EguPrx144 192 2e-62 1..120 20..183
EgrPrx144 190 1e-61 1..120 20..183
EcamPrx144 188 4e-61 1..121 1..165
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38220430..38220537 108 N° 2 38220172..38220297 126 N° 3 38219901..38220047 147  
complement(join(38219901..38220047,38220172..38220297,38220430..38220537))


exon

Literature and cross-references EgrPrx[P]143 ( Eucgr.I02714 / Egrandis_v1_0.050432m)
DNA ref. Phytozome 12:   scaffold_9 (38220537..38219901)
Protein sequence: EgrPrx[P]143 ( Eucgr.I02714 / Egrandis_v1_0.050432m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   126 (110)
PWM (Da):   %s   13532.83 (11831.0)  
PI (pH):   %s   4.66 (4.50) Peptide Signal:   %s   cut: 17 range:17-126
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLVLLSMSCHAQLSSTFYDESCPDALTAIRTSIIITNRGSVRGYEVIDYAKSEVEKICPGVVSCADIVAVIARDAFVAVGSPSWTVKLERRDSTTASPSLASSDLPSFREGLEKLVPKFASDEFFM*

Retrieve as FASTA  
Remarks Pseudogene from genomic (Both 5' and 3' ends are missing). Incorrect prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGTACTCTTGAGCATGTCCTGCCATGCACAGCTTTCCTCCACGTTTTATGACGAGTCATGCCCGGATGCGCTCACTGCAATAAGGACTTCCATCATAATCACGGTCTCAAGGAAG
CGCCAGATGGCTGCTTCTCTCATCTGACTCCATTTCCACAATTGCTTCGTCTAGGGTTGCGATGCATCGATACTACTGGACAATAGCACCACCAACTCTAGCGAGAGAGACACCCCATAG

AATAGAGGCTCTGTGAGAGGTTACGAGGTGATAGACTATGCAAAGTCGGAAGTAGAGAAGATCTGTCCAGGAGTCGTGTCTTGTGCGGATATTGTTGCCGTCATAGCTCGAGATGCTTTT
GTTGCC
GTAAGTCTTCCCATAATTCTGAAGATATGCATCTTATGACCACTTTATTACTTTCGAATATCGACTACAAGTTTAAATCGTTTTCCTTACCAATATAATTGATGATGTTTTGAC
GAAAATGTAGGTTGGTAGTCCTTCTTGGACGGTGAAGCTCGAAAGAAGAGACTCAACCACCGCAAGCCCATCACTTGCATCAAGTGATCTTCCGTCATTTCGAGAAGGCCTCGAGAAACT
CGTGCCTAAATTTGCAAGTGATGAGTTTTTTATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGTACTCTTGAGCATGTCCTGCCATGCACAGCTTTCCTCCACGTTTTATGACGAGTCATGCCCGGATGCGCTCACTGCAATAAGGACTTCCATCATAATCACGAATAGAGGCTCT
GTGAGAGGTTACGAGGTGATAGACTATGCAAAGTCGGAAGTAGAGAAGATCTGTCCAGGAGTCGTGTCTTGTGCGGATATTGTTGCCGTCATAGCTCGAGATGCTTTTGTTGCC
GTTGGT
AGTCCTTCTTGGACGGTGAAGCTCGAAAGAAGAGACTCAACCACCGCAAGCCCATCACTTGCATCAAGTGATCTTCCGTCATTTCGAGAAGGCCTCGAGAAACTCGTGCCTAAATTTGCA
AGTGATGAGTTTTTTATGTGA

Retrieve as FASTA