Entry information : EgrPrx[P]03
Entry ID 8144
Creation 2011-02-25 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EgrPrx[P]03
Name EgrPrx[P]03
Class Class III peroxidase     [Orthogroup: Prx046]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx[P]03
start..stop
S start..stop
EgrPrx[P]14 343 6.93e-123 1..173 1..173
EglPrx[P]14 339 1.96e-121 1..173 1..173
EguPrx[P]14 337 9.66e-121 1..173 1..173
EcamPrx[P]03 260 5.18e-91 1..134 1..133
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8144' 'complement(join(405906..406024,414606..414810,414976..415173))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 414976..415173 196 N° 2 414606..414810 203 N° 3 405906..406024 117  
complement(join(405906..406024,414606..414810,414976..415173))


exon

Literature and cross-references EgrPrx[P]03
DNA ref. Phytozome 12:   scaffold_1 (415173..405906)
Protein sequence: EgrPrx[P]03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   19073.54  
PI (pH):   %s   7.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSCSVRHNIEAAATIKLP*KLQWLYYQNLCPDAKKYMWDHVEFYWKEDRTLAPSLI*LFYFDCFVGCDALILFNGPDSKKTASQNAPLLALPMETIDKAKEVLEHHCPGVVSCANIINL
AARDAVVLVCNMVC
NMSHPFSTGRRDENSSSAKSVDLPLQAVLGKPVLAYFKS

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stop codons in frame, exon 4 is missing). No prediction from Phytozome. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTCATGCTCAGTGCGGCACAACATCGAGGCAGCAGCAACAATCAAACTGCCGTAGAAGTTGCAGTGGCTTTACTACCAAAATTTGTGCCCTGACGCCAAGAAGTACATGTGGGAC
CATGTTGAGTTTTATTGGAAAGAAGACAGGACCCTCGCTCCCAGTCTCATCTAACTATTTTACTTCGATTGCTTCGTC
ACCGTACGTGTCATATGTTTCTTTTTCCCTTTCTCATACGAT
CTTGAACTCCGCATCGCTTCAATATCAGGTTTCCATCGCCTTTCTAAGCACATGATACCCTTTCACCTAACGGTTTGAACCTCTCAAACCGGGCTTTCTAATGTACGAGCTTTTGTAAAA
CAGGGGGGTGTGATGCGTTGATTCTATTCAATGGGCCAGATTCAAAGAAAACAGCATCGCAAAATGCACCGCTTCTAGCGCTTCCTATGGAGACGATTGACAAGGCCAAGGAAGTCCTGG
AACACCATTGTCCCGGGGTAGTATCTTGCGCCAACATAATCAACCTTGCTGCTAGAGATGCTGTTGTCTTGGTATGCAACATGGTTTGCA
GTTTTTTTCCTTTTTGAGCTTGAAAAGAGA
TCGTTTAGGCTGCTGCACTGATGATTGACATGCTGTTAGCTTGAGTTTTGGAGCGTTCGATATGGAAAAAAATTAGAATTATTGATGCAATAATGATGCTGCGACATGCGGGAGGGATGT
CTTGATATAGCTAGTATAAGTACCTAGAGGGGGTGAATAGGTATATAAAGGATTTGTCTCGATAATTGCACAATACTAGACAGTTGATAGATTTAAGACAAACAATAATCAAAGTAAGAC
TGAGAGAAGAGAAAATTGAACACGCGGTTTATAGTGGTTCGGCTTATGTCAAGCCTACGTCCACTCTTCTGCACTGACAGCCTATTGGCTGGATTCCACTATGAACAAAGAGATGTTACA
ATGTTGTTCTCCCTTGCTTTCTCAGTGTAGATGATCTACCACACTCGCTCAAGGTACCACTAAGTATAAACACTCTTTGTGTGTACAATTTTGCTCAAAATGTATCGACTGATAATCAAG
GTACTTCAGACTCTGAAATTTCTCTATCGATCATGCACTAAAGCAACTAGAATGTCTTCCTTTTATACTCCTTTATACCATCATATCCGTTGGCACTTACCAAAGGAATTCCTCAAATCT
ACCCATTGGACGGAATCAATCAAGAAGATCATTCGAGCTATTAAAGGAACCTGACGATAGCCCATCAATCATGTTCGCCCATACAATCAAGATCTTGGTTTCCAATAATAGAACATTCCA
AGAATATTTCGTCGACCATCGGATCTTCAAACGATCTTGATTACGAATAAAAGAATCCGTTATATTTATCCAGCCAAGAGATCTTCTCCAGAGAATAAGACCAAATCCTCAACCAAATAC
TTTGACTCTGGATTGCCTTCGTCACTGGATTAGAAAAACTGTCAATGAGAATAGTCTTGAGTCTTGAGTCTTGAGTCTGGTGATCTGAAAGTCTTCAGACTCTAAACAGAAGGTCTGTAC
TTATCCAAACTAGACTGATAGAAATGTTTTGTCAGCTTCAAAATATTCTTGAAAGATTTCTCCAACAATCTCCCCCTTTTTGATGATGACAAAACTTTCCTGTAGATTTGAACAACTTTG
ACCTGCAAAACATTACTCAAACAATATGGCTATCTCATAAAATGAATCAACCAGACTCTGCACCCACAGAAAATTGGTTAGTTTTTCATGAGTAAGACCATATAACAACACTTGATATAA
ATGCAAACAGTCAAACATCAAAATCCACACAAGTCAGTCAAATTCAAGTTCACACCCAAGTCATACTCAAATATTCAAACACGTCAAAGTTTTAAAGAGTTTAAAGAGTTCAAATTGCAA
TTCTCCCCCTTTTTGTCATCATTAAAAAGGTGAGAAAAAAGTCACAATCTGGAAATCTCCCATCGATTGGACGATGCCTTCCAGCCTCTTCAAGTCTTCCCGTAGATGAGCCACCTCTTC
TCCTTTGGCATTGGCTTGAATTTGAAGAGCGAGGGCTTTCATTTGATCTGCCAGGGTAACAGAAGATGCTTGTCCAGCATTCTTCATGACTTGAAGTTCACATTCCAAAGCATATATTTG
ACCCTACATTTCTAGAAGAACATCAAGGATACGACGAAAATCTGTTGTATTATCCGTCTGTGTGCTTGCATTTGCTTTTTCGGATGGAGTGAAGTCAGACGATGGAACTTCAGTGTAATC
GAGTAGATTTGGTGTTGACGTATCATGTCCTTCTTCAGGCATTTGAGAAGCCCGAAAGTCTTTTGGATTTGCTGGTGAGCGACTCACACCTTCACTGTTGACAGCATGTGGTGTAGTCCT
TCCTTGCTCACCATCTCCCCCTGTCTCTAAGACCTCAATTGGGGAAGAGTGATGGTCATGCTCTTCTGCACCTTGATTCCCTTCCTTTGCAGCTTCATCTGCAGACTTTTCTTTTTCTGC
TTCTCCTTCTGCTTCAGCTTCTTTCTCTTCATCTTCTTTCTCTTTCTCTTGTTGCTCCTCTGCTTCTCTGTTCTTTGCTTGTCCCTCTTCTTCTCTCTGTTCTTTTTCTTATGCTTCTTT
TCCTTTCTTCTGATGTTCTGTTGATTCAGGTACAGAACGTCTGGTTCTTTTCAATGCAGGGATAGTGAAATCTTCCTCTTCATCTTCATCCTCCAAGATAAGAGCTCTTTTCTTTTTGGA
TGGAGCACCCATGGGCTCATTCCCTTTTTTCTTTGATGCGGAAGATGCTGGAGTCTTCACTTTGAACTTCTCCATTGCCTTACTAAGCTCTTTCAGACGCATTTTAGTCAGCATTTTCAA
ACCCACCACCATTTTGTCGCATGGTCAAACACAAAGAGTATGTGGAGGTTCAATGTTCAAGTGTCTGAAGATCGTGGTCACAAGACCAGAATAAGGCAATTGGCCCTTGTCCTTCACCAT
TGCTCTGTACATGTGAAAGAGAATGGTGTGAGGGAGAGAGAACTTTTTCCCTGAATTGATCGCATACATCAATTTTGCCTCGGAATTAGACATGTCAGTCTTTGATGTAGACTTTGGCCT
GATACAGTTGATCACAATTTTGTGAAGCAAGATGTTGATGGCATGCATTCTTGAATAGGTAACTCTTCCTTCTGTACTCCTGTCTTTGACAAGTTCCAGAGTGGTACGAGCGATTGAAAC
CTTGATTGGTTTATATCGTCCTTTTTCGACTCCAATTATGTCTGCCAACATGTCCACATCCACCTCATAGATTTGGTCTCGAACACTGAATGATATTCTATTCACATCCAAAAAGCTAAG
ATTCGAATAGAAGTATGCTGTTAATTGCGCATAACCGTCTGTGGTATCGGAGCAGAATTGCTCAAGTTGAAGCAGATTTAACTTCTCCCTTAAGTTCACATTAATGGCATCCAAGAAATC
GAAATCAACACTCCTAGGATTTATCACCCCTCGTTTCAACAATCTGAAGAACAGATTCTCCTGTTCCTTCGATTTAAACAAGTCCTTCCTTTTTCCCTTCACCTTCGCAGCAACTCCCAT
TAGAGGTTGAAATTCTCTGAACATTTTATCATCATCGTTCCCGTTAGTCGGATTCAGTCCCGATACACAAGGGTCACTTGGAATATTCGCAAGTGCTTCCTCAGCCTTTCCTTTGGGAGC
AATTCCCAAATCCTCCATTCGTCGCAGAAATAGATACTCATTCCCATATTTTTTATCTTTAAGGAAATCATCCATATAGTTCAGCGGAGTCCCAATGCTCTTCATTGCACGATAGAGCTT
GTAAATAAAAGAGGGTTTTTGGACCTCTTTACAAGGTCTGCGTCCTCGATTATTTCTTCCTCCGGTTGATGACTCACATCTTGTGGGGTAGATGATGAAGAGTGACGTGGTGGAGAGTGA
ATCGGGCTCTATTGCTGACTCGGTAAATCTTCCTCTTCGGTGAGATCGAAATGGGTAGGTCCCTCCTTCATTCTCTGTGGTCCCCTGTTTGCGATTCTTGAAGACTTTCTCGAGAAAGAC
ATCATTTCTTGTCGTTGAAAGATTCCTTTACTCGCTTTCCCAAGAACATATGACAACTTTCTCGAAGATAAATACGAAGTAGAAACAGGATTGGGAGGAGAATGCCTTTTAGGGTTTTGA
AGTGTAACCGAGGAAAACTGTATGTATATAACTCAGTTTAAAAAGGAAAAACCAATCGGCACAAAGGAAAATGAACAGATGCCTCTTTTAAAATCAATAACTGCCAAATAGAGGTTAATC
CCTTTTAAAAAGACAAGATTCAGTTTTTCATGGAAATTATAAACTAATGATCGTACCTTTTCGAGATTGAATATAATAACAACTTACAGTCTATAGCCATGAATGTCTGAGTCTGAGGAT
TGGAGAGTATCTAGACTTTAACTTCCTCAAGCTTTAAAATGTTGAGTCTGGAGAGTCTTTAGACTTTAACTTCCTCAAGCTTCAAAATGTTGAGTCTGGAACGGATGAAATCGAATTGAT
TTTTCTGCAAAGGCTTTGTGAATATATCCGCTAGTTGATTTTTTGAATCAACAAATTGAATTGAGATTTCTCCATTTTGAACATGATCTCTAATGAAGTGATGGCGAATCTCTATATGCT
TTGCTCTTGAGTGAAGGATTGTATTTTTAGTGAGATTGATTACGCTAGTGTTGTCACATCTAATCTCTGTGCATGAGTCTTCAATTCCAAAGTCTTGTAGCTGTTGTTTTATCCACAGAA
TTTGCGAACGGCAACTTCCAAGGGCTACATACTCTGCTTATGTTGTTGAAAGAGCCACAGTGCTTTGTTTCCTTGAAAACCAAGACACTGTCCTGCTTCCAAGCAACTAGCAAGTTCCCG
AAGTGTTTTTTCTATCAACTCTGCAACCGGCCAAATCTGCGTCTGAATATCCCAGAAGATTAAAGTCTCCCTTATTAAGATACCAAAGACCGATGCTTGAAGATGAAGCAACGTATTTAA
TAATACGTTTCGCAGCACTGAGATGGGATTCTCTAGGATTTGATTGAAACCTAGCACAGATGCAAACACTCAACAAAATGTCAGGTCTAGAAGCAGTAAGATAAAGAAGTGAACCAATGA
TGCTCTTGTACAGCTTTTGATCAACTTTCTTCCCTTCTTCATCTTTGTCTATCTTCAAAGAACTTGACATCGATATGTCGGTCTTTTTGCACTTTTCCAGTCCAAACCTTTTGACAAGAT
CATTAGCATATTTTTCTTGATAAATAAAAGTTCATTCCTTCAATTGTTTTACTTGAAGACCAAGAAAGAATGTTAACTCTCCCATCATACTCATTTCAAACTCATCATGCATAGACTTAG
AAAATTTCTTGCACAGACTTTCATTAGAGGATCTAAAAATAATATCATCCACATATATTTGAACAAGTAAGAAACTTTTGTTTTCCTTTTTGATAAATAAAGTTGTATCTACTTTACCTT
TGACAAAACCATTCTGTATTAAGAACTTACTTAGTCTGTCGTACCAAGCTCGAGGTGCTTGCTTTAAACCATACAAAGCCTTTTTCAGTCTAAAGACTGAGTCTGGCTTCTTTGGGTCTT
CAAACCCTGGTGGTTGTTCCACATAAACTTCCTCATGGATAAATCCATTTAGGAAGGCGCTTTTGACGTCCATTTGGAATAACCTGAAATTTTTATAACAAGCAAACGCAAGTAATAGTC
TAATAGCTTCTAACCTTGCTACTGGTGCGTAAGTCTCATCATAGTCTATTCCTTCTTCTTGCGTATATCCCTTGGCCACGAGTCTTGCTTTGTTTCGTACGACTCTTCATTTCTCATTCA
TCTTGTTCCTCCAATGCTCTGGGTTCTGGTTGGTCCGAAGATATCCATATGCAGCAACTGCTTTCCCAGAATACATGGAGTGCATGGATCAGTCTTTTGGTATGGTAATTTGGGTAGACC
TCAAACAAGCTGCTTTGATGAGATTTTGGCTAATTGCTTCATGTTGACATGACCAAGATTTCTGTGCCATAAGCTTGCTTCGTCTTGAATTGAGATTAGACATTACGATTCATTTGGTTT
CACATCCAGAAGATAGATATTTCCATGTCTTCGACCCATGAAAGACTGAGTAGAGTCTTTACTGATTCCAGAACATATTCCTTCTTGAAAGAAGATCTTAAAACCAGTATTACACAATTG
ACTAATGCTGAGAAGATTGTAATTGAGTCCTTCCACTAAGGAAACATTACTTATTGTGAGATTTCCAATTTTCACAGCTCCAAATCCCACAATACTTCCTTTGTTGTTTCCTCCAAATGA
AACTTTTCCACCATTTACTTGAGCAAGCTTTATAAAACAGTTTGAGTCTCCTGTCATGTGTCTTGAGCATCCACTGTCAAGATACCACTTTACCTTTTTTCTTGACGGAGACCTACATTT
AAAATAAAGTCTCAAGCTTTCTTTGGTATCCAAACTTTCTTAGGTCCTTTGGTGTTAGTAAGATAAGCAATATTAGCCCATACCTTTTTAACAGGTTTCCAAACCATATGACACTCTTTT
TCAAAGTGATCCTGACTGTTGCACTTTGAACATCTTAGAGCATTTCGACTTACAGACTTTACAAAAACTTTCTTGAAATGATTTTTATAAGCCTCTCTCGGGGGTCTTTTCTTAATTCTT
TCTTTTACTTTAGGAAAATCAATCAAGGGAATTATTTCTGCTGTCATACCTAGACCGGACTTATTGAAGTAAGGTCTTTAAGCTGAAAGAATTTTTTCAAGTTTTCGGACCCTATTGAAA
ATTTCTTTGAAATATTTGATAAGTCGGTTTTTAAAAGAGCATTTTCTTTTAAAAGATTATCTTCATTTTCTTTAAGAGTGTAAACAGTCAAGTCTAGACTTTTAACTATTTCTTCTAAAA
CGTTTTCCTTTTGTTTTAGAGCTGAGTTTTCCTTCTTAAGTTCGGAAATTCTTTTGAGAGAAGTCTTAAGACTAAAACACAGTTCATCAATGTATTTAGAAACTTTGACAGGAATTTTAA
AATTACTTGCCTCAAATTCACTGTCAGAGTCTGATCCAGAGTCTGAGTCTGATTGTGCCATCAGACATAGGTTGGCATATTCATTATCACTTTCTTCACACTCTGTATCACTCCAGGTTT
CGGCTTTGAGAGCTTTTCGAAATTTTTCAGCTTTTCCTCTCTTCTTCAGAAGAAGAGGACAGTTGGGTCTGATGTGTCTCTTTTTCTTACATTCAAAGCAAACTACATCTTTGTTTGGTT
CCTCATCATCAACAAACTTGGTCTGTTGTCTTTGAAAGCTTTGTTTCTTTGAGTTGAACCTTCTTCCTTTTCTATTCAGTTTTCTGAATCTTCTTATCATGAGAGCAAGCTCCCCATCAT
CCATATCATCTTCAGAATCTGTATCATCAGAATCATCATTTGATTTTAATGCAATAGATTTCTTACATTTTGGATCTTCATCTTCATTGATCCGTTCCACTTCATAAGACTGAAGAGTTA
CAATCAGCTCGTTGACAGATAGTGGCATAATTCTTTGCGTCTCTCTAATTGAAGTCTTTACGTGATTCCAATCCTTGGAGAGTCCACGCAGTAGCTTGTTTACCTTCATGGGATCAAAAA
TTGTTTGTCCTTGATTCTCAAGACCATTGACAATATTTGTAAAACGGCTAAACATGTCAGTTATAGATTCTCCTGGTTTCATTTTGAAGGTTCATATTGACCGAGGAGAATGTTAATTCT
GGTTTCCTTCACTCGATTTGTTCCTTCATAGGTGATATGCAATCTGTCCCAAACTTCTTTTGATGTAACACAAGAAGATATTCTGTTATATTCAGTGGTAACAAAGCACAATATAAAGAG
TAAATTGCTTTTGCATCGAGTGCTTGTCTCTTGATTATCTCTTCCTGAGTCATTCCGCTGGTCTCAACAGTTTCTTTCCCTCTTTCAGAGACTAATGCAACTGTAGGAGTAATTCATTTT
TCTACAATGTCCCATTCCAAAGGATCCTTTAATCGTAAGAAAGTTTTCATCTTGTTCTTCCAGATGTTGTAATCATTTCCATCAAAGTAGGGTGGTCTGGTATTGCTTTGCCCTTCCATC
AGCCCTAATGCTAGCATACTAGCCATGGATCTTTTACTCTGAAGTAAAACACTTCAAATAAAGTGAGTACACGAGCTCTGATACCAATTGATATAGCTAGTATAAGTACCTAGAGGGGGG
TGAATAGGTATATAAAGGATTTTTCTCGATAATTGCATAATACTAGACAGTTGATAGATTTGAGACAAACGATAATCAAAGTAAGACTGAGAGAAGAGAAAATTGAACACGCGGTTTATA
GTGGTTCGGCTTATGTCAAGCCTACGTTCACTCTTCTGCACTGACAGCCTATTGGCTGGATTCCACTATGAACAAAGAGATGTTACAGTGTTGTTCTCCCTTGCTTTCTCGGTGTAGATG
ATCTACCACACTCTCTCAAAGTACCACTAAGTATAAACACTCTTTGTGTGTACAATTTTGCTCAAAATGTATCGACTGATAATCAAGGTACTTCAAACTCTGAAATTTCTCTATCGATCA
TGCACTAAAGCAACTAAAATGTCTTCCTTTTATACTCCTTTATGCTATCATATCCGTTGGCACTTACCAAAGGAATTCCTCAAATCTACCCGTTGGACGGAATCAATCAAGAAGATCATT
GGAGCTATTAAAGGAACCTGACGATAGCCCATCAATCATGTTTGCCCATACAATCAGGATCTTGGTTTCCAAGAATAGAATCTTTTAAGAATATTTCGTCGACTATCGGATCTTCAAACA
ATCTTGATTACGAATAAAAGAATCCGTTATATTTATCCAGCCAAGAGATCTTCTCCAGAGGATAAGACAAAATCCTCACCCAAATACTTCGGCTCTGGATTGCCTTCGTCACTGGATTAG
AAAAACTGTCAATGAGAATAGTCTTGAGTCTTGAGTCTTGAGTCTGGTGATCTGAAAGTGTTCAAACTCTAAACAGAAGGTCTGTACTTATCCAGACTAGACTAATAGAAATGTTTTGTC
AGCTTCAAAATATTCTGGAAAGATTTCTCCAACACATGTCGCACCCCTTTTCGACGGGGAGAAGGGACGAGAATTCATCCTCCGCAAAGTCAGTGGACCTCCCGTTGCAGGCTGTCCTGG
GGAAACCGGTGCTCGCTTACTTCAAATCAAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCTCATGCTCAGTGCGGCACAACATCGAGGCAGCAGCAACAATCAAACTGCCGTAGAAGTTGCAGTGGCTTTACTACCAAAATTTGTGCCCTGACGCCAAGAAGTACATGTGGGAC
CATGTTGAGTTTTATTGGAAAGAAGACAGGACCCTCGCTCCCAGTCTCATCTAACTATTTTACTTCGATTGCTTCGTC
GGGTGTGATGCGTTGATTCTATTCAATGGGCCAGATTCAAAG
AAAACAGCATCGCAAAATGCACCGCTTCTAGCGCTTCCTATGGAGACGATTGACAAGGCCAAGGAAGTCCTGGAACACCATTGTCCCGGGGTAGTATCTTGCGCCAACATAATCAACCTT
GCTGCTAGAGATGCTGTTGTCTTGGTATGCAACATGGTTTGCA
ACATGTCGCACCCCTTTTCGACGGGGAGAAGGGACGAGAATTCATCCTCCGCAAAGTCAGTGGACCTCCCGTTGCAG
GCTGTCCTGGGGAAACCGGTGCTCGCTTACTTCAAATCAAAG

Retrieve as FASTA