Entry information : EgrPrx26
Entry ID 8145
Creation 2011-02-25 (Qiang Li)
Last sequence changes 2011-03-17 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-02-28 (Qiang Li)
Peroxidase information: EgrPrx26
Name EgrPrx26
Class Class III peroxidase    [Orthogroup: Prx078]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx26
start..stop
S start..stop
EglPrx26 673 0 1..325 1..325
EguPrx26 668 0 1..325 1..325
EcamPrx26 667 0 1..325 1..325
EgrPrx39 481 7e-173 11..325 11..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11080583..11080810 228 N° 2 11080949..11081143 195 N° 3 11081262..11081816 555  
join(11080583..11080810,11080949..11081143,11081262..11081816)


exon

Literature and cross-references EgrPrx26
DNA ref. Phytozome 12:   scaffold_1 (11080583..11081816)
Protein sequence: EgrPrx26
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   35618.18 (33214.9)  
PI (pH):   %s   9.24 (9.07) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESKGGNRFLAVLLLSITTTALSFPNHHTGLTPYYYNYACPQALPTIRQVVKAAVKKERRMGASLLRLHFHDCFVNGCDASVLLDPTPTIDTEKLAGANNNSARGFEVIDQIKEEVDKVCGRAVVSCADILAVAARDSVVLLGGPWWNVRLGRRDSTTASRTTANTDLPAPFMDLSTLTSSFQKQGLDAKDLVVLSGGHTLGFAQCFTFKDRAHNDSDIHPKFAKKLQSICPRAQSESDSNLAKLDPTSTRFDTLYYKNLLKQKGLLRSDQALFGSGNTDELVRTYSDDATAFWKDFAKSMVKMGNIKPLTGNLGQVRNNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, introns 1 and 2). No prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCGAAAGGCGGGAATCGTTTTCTCGCAGTTCTCTTGTTGAGCATCACGACCACAGCTCTCTCTTTTCCTAATCACCACACTGGCCTCACACCTTACTACTACAACTACGCTTGT
CCTCAAGCTTTGCCGACCATCAGGCAAGTCGTCAAGGCAGCGGTGAAGAAAGAGAGACGCATGGGTGCTTCGTTACTGCGTCTGCACTTCCATGACTGCTTCGTTAAT
GTACGACACATT
GCTTGTCTCTTGAAGTACTTACGTAGCTGTAACCGATTGCGATATAAGTTTTGTTTTTTCTTTTTTGGGGCACGGGGGGTGGGGTTTATGTCTGTTGAATTAACATTGCTCTGACTGACC
GTGCAGGGCTGTGATGCTTCGGTACTTCTAGATCCGACGCCCACCATCGATACCGAAAAGCTCGCCGGCGCAAACAACAATTCTGCTAGAGGTTTCGAAGTGATCGATCAGATCAAGGAG
GAGGTCGACAAAGTTTGTGGCCGTGCGGTGGTCTCTTGCGCAGATATTTTGGCAGTTGCTGCTCGTGACTCCGTCGTTTTG
GTAAGTGGTTGCGCTTGCGTTGAATTTTTAAGTCAATAC
GTGTAACTAATCAATGTAATAGCACATATTTACACAGTGAACTGTTGATGATTTCGATTCTTGGTATTTGGTAATGTAGCTGGGAGGGCCATGGTGGAACGTAAGGCTTGGAAGAAGAGA
CTCGACCACCGCGAGCAGGACGACCGCCAACACGGACCTGCCGGCCCCGTTCATGGACCTAAGCACACTAACTAGCTCGTTCCAAAAACAAGGCCTAGACGCCAAAGACCTGGTCGTTCT
ATCTGGGGGACACACGCTTGGGTTTGCGCAATGCTTTACCTTCAAGGATCGGGCCCATAACGATTCGGACATCCACCCTAAATTCGCAAAGAAGCTCCAATCCATTTGCCCACGCGCCCA
ATCCGAAAGCGACTCGAACCTCGCTAAGTTGGACCCGACGTCGACGCGCTTCGACACGTTGTACTACAAGAACTTGTTGAAGCAAAAGGGTCTCCTTCGATCAGATCAAGCACTCTTCGG
TAGTGGCAACACCGATGAGTTAGTGAGGACGTACAGCGACGACGCCACTGCATTTTGGAAAGATTTCGCGAAATCGATGGTCAAGATGGGGAATATAAAGCCGTTAACCGGAAATCTTGG
TCAGGTTCGCAATAATTGTAGAAGGGTGAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCGAAAGGCGGGAATCGTTTTCTCGCAGTTCTCTTGTTGAGCATCACGACCACAGCTCTCTCTTTTCCTAATCACCACACTGGCCTCACACCTTACTACTACAACTACGCTTGT
CCTCAAGCTTTGCCGACCATCAGGCAAGTCGTCAAGGCAGCGGTGAAGAAAGAGAGACGCATGGGTGCTTCGTTACTGCGTCTGCACTTCCATGACTGCTTCGTTAAT
GGCTGTGATGCT
TCGGTACTTCTAGATCCGACGCCCACCATCGATACCGAAAAGCTCGCCGGCGCAAACAACAATTCTGCTAGAGGTTTCGAAGTGATCGATCAGATCAAGGAGGAGGTCGACAAAGTTTGT
GGCCGTGCGGTGGTCTCTTGCGCAGATATTTTGGCAGTTGCTGCTCGTGACTCCGTCGTTTTG
CTGGGAGGGCCATGGTGGAACGTAAGGCTTGGAAGAAGAGACTCGACCACCGCGAGC
AGGACGACCGCCAACACGGACCTGCCGGCCCCGTTCATGGACCTAAGCACACTAACTAGCTCGTTCCAAAAACAAGGCCTAGACGCCAAAGACCTGGTCGTTCTATCTGGGGGACACACG
CTTGGGTTTGCGCAATGCTTTACCTTCAAGGATCGGGCCCATAACGATTCGGACATCCACCCTAAATTCGCAAAGAAGCTCCAATCCATTTGCCCACGCGCCCAATCCGAAAGCGACTCG
AACCTCGCTAAGTTGGACCCGACGTCGACGCGCTTCGACACGTTGTACTACAAGAACTTGTTGAAGCAAAAGGGTCTCCTTCGATCAGATCAAGCACTCTTCGGTAGTGGCAACACCGAT
GAGTTAGTGAGGACGTACAGCGACGACGCCACTGCATTTTGGAAAGATTTCGCGAAATCGATGGTCAAGATGGGGAATATAAAGCCGTTAACCGGAAATCTTGGTCAGGTTCGCAATAAT
TGTAGAAGGGTGAATTAA

Retrieve as FASTA