Entry information : EgrPrx02
Entry ID 8146
Creation 2011-02-25 (Qiang Li)
Last sequence changes 2011-05-23 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-05-16 (Qiang Li)
Peroxidase information: EgrPrx02
Name EgrPrx02
Class Class III peroxidase    [Orthogroup: Prx063]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx02
start..stop
S start..stop
EcamPrx15 686 0 1..330 5..334
EguPrx02 682 0 1..330 1..330
EgrPrx15 682 0 1..330 5..334
EglPrx15 635 0 1..329 5..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 400752..400985 234 N° 2 400372..400557 186 N° 3 396373..396532 160 N° 4 395705..396117 413
complement(join(395705..396117,396373..396532,400372..400557,400752..400985))


exon

Literature and cross-references EgrPrx02
DNA ref. Phytozome 12:   scaffold_1 (400985..395705)
Protein sequence: EgrPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (312)
PWM (Da):   %s   36790.79 (34706.7)  
PI (pH):   %s   7.34 (6.98) Peptide Signal:   %s   cut: 19 range:19-330
Sequence 371
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWWQLLLSALALLRSCQAQPIEAKATIKLPPPLQWHFYQNSCPDVEKYVRDQVEFYWKQDSTLAPKLIQLLYTDCFIKGCDASVLLDGPDAEKTAPQNAAILGFPLEVIDKVKEVLEQHCPGVVSCADIINLAARDAVVLAGGVSYPVPTGRRDGNSSNAKLVDLPKRAVPWEKVIPYFKIRGLDLFDVTTLLGGHTLGRTSCEFIAERLYEFNNTGKPDPSMDPSFLAELRVQCPPNSTNSVYLNPDSGSSNRFSKTFYSRVLNHRAVLSIDQQIAAHKESLQIARRYDANFEDFLKMFGYSMTKLGNTWLLPGDQGEIRKNCRVVNGK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns). genomic sequence contains a large fragment of "n" in the intron 2. 3 extra aa (KAR) at the end of the exon 1. No prediction from Phytozome. Containing motif 'YTDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGTGGCAGCTGTTGCTATCGGCGCTCGCGTTGTTGCGCTCGTGCCAGGCACAGCCCATCGAGGCCAAGGCTACGATCAAGCTGCCGCCGCCGCTGCAGTGGCATTTCTACCAGAAC
TCGTGCCCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTCATCAAG
GCACGT
ACCGTCTGTTCATTTCCTTCTTTCTGTCTCTCTCACGATCTTGAAGTCGGCATCACTTTAATCATCGAGTTTCCGTTGCCCTATCTAAGCATGCCAAATCCTTTCACCCGTTAGTTTAAC
TTCTCGAACTGGGCTTTCTAATATACCACTCTTTTGTGTACGTATGTATGGTTATGTGGATAAAACAGGGATGCGATGCGTCGGTTCTCTTGGACGGGCCAGATGCAGAGAAAACAGCAC
CACAAAATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGTCCCGGGGTCGTGTCTTGCGCCGACATTATCAACCTTGCCGCTAGAG
ATGCTGTCGTCTTG
GTATGCAGCATGGTTCTCAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNCAAAAGAGATTGTTTGGGCTGCTGCACTGATGATAATCGACGTGCTGTTAGCTTGAGTTTTGAAGCGTTCGATATGGAAAGGAAAAAAATTAGAATTACTAATGTGATAAT
GATGTTGTAATAGGCTGGAGGGGTGTCGTACCCTGTTCCGACGGGGAGGAGGGACGGAAATTCGTCCAATGCGAAGTTGGTGGACCTCCCAAAGCGCGCCGTCCCGTGGGAAAAGGTGAT
CCCTTACTTCAAAATAAGGGGCTTGGATTTGTTCGACGTCACTACTCTACTTG
GTACGGTCTAACCCTCGAATGAAAAGTGTTTATTTGACTCCGACCTCGTTACATTACCTTAAGATCT
TAACCAATCCAGGCAACTCATTTAGTTCAGTGAATCACGCTGTCCCTTCTAGCTTTCATGTAATCCGAACCAATCCTCCCAATGATCTCCTCCAAGTGCACAAAAATGGCATGCTCACGT
ATCATGTCAAACTCTCAATCATAACCAATTCCTCCTAACTTTTCCAAAAACAACTTAAATTTTGCCAGGGGGGCATACACTGGGCAGGACCAGCTGCGAGTTCATCGCAGAAAGACTGTA
CGAGTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCGCCAAACTCAACGAATTCAGTGTACCTAAACCCTGACTCAGGCTC
GAGTAACAGGTTCAGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATCGCCGCCCATAAGGAGAGCCTCCAGATTGCCCGGCGGTACGATGC
CAATTTTGAGGACTTCCTGAAGATGTTCGGCTATTCAATGACCAAGCTGGGGAACACCTGGCTCCTACCAGGGGATCAGGGTGAGATTCGCAAGAATTGCCGAGTCGTGAACGGGAAATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGTGGCAGCTGTTGCTATCGGCGCTCGCGTTGTTGCGCTCGTGCCAGGCACAGCCCATCGAGGCCAAGGCTACGATCAAGCTGCCGCCGCCGCTGCAGTGGCATTTCTACCAGAAC
TCGTGCCCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTCATCAAG
GGATGC
GATGCGTCGGTTCTCTTGGACGGGCCAGATGCAGAGAAAACAGCACCACAAAATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGT
CCCGGGGTCGTGTCTTGCGCCGACATTATCAACCTTGCCGCTAGAGATGCTGTCGTCTTG
GCTGGAGGGGTGTCGTACCCTGTTCCGACGGGGAGGAGGGACGGAAATTCGTCCAATGCG
AAGTTGGTGGACCTCCCAAAGCGCGCCGTCCCGTGGGAAAAGGTGATCCCTTACTTCAAAATAAGGGGCTTGGATTTGTTCGACGTCACTACTCTACTTG
GGGGGCATACACTGGGCAGG
ACCAGCTGCGAGTTCATCGCAGAAAGACTGTACGAGTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCGCCAAACTCAACG
AATTCAGTGTACCTAAACCCTGACTCAGGCTCGAGTAACAGGTTCAGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATCGCCGCCCATAAG
GAGAGCCTCCAGATTGCCCGGCGGTACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATTCAATGACCAAGCTGGGGAACACCTGGCTCCTACCAGGGGATCAGGGTGAGATT
CGCAAGAATTGCCGAGTCGTGAACGGGAAATA

Retrieve as FASTA