1. Browse the Database
  2. View Redoxidase
Entry information : EgrPrx24
Entry ID 8164
Creation 2011-03-01 (Christophe Dunand)
Last sequence changes 2011-03-01 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-02-15 (Qiang Li)
Peroxidase information: EgrPrx24
Name EgrPrx24
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx24
start..stop		 S start..stop
EglPrx24 644 0 1..318 1..318
EcamPrx24 637 0 1..318 1..319
EguPrx24 637 0 1..318 1..318
EgrPrx25 572 0 1..318 1..319
Gene structure Fichier Exons►


exon

Literature and cross-references EgrPrx24
DNA ref. Phytozome 12:   scaffold_1 (11036804..11039935)
Protein sequence: EgrPrx24
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (293)
PWM (Da):   %s   33492.32 (30895.0) Transmb domain:   %s   o10-32i
PI (pH):   %s   6.64 (6.65) Peptide Signal:   %s   cut: 26 range:26-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACESSSVKPVYLLLLCFLLGTASAQLSSTFYSKSCPSALRTIKS
GVSSAVSSEARMGASLLRLHFHDCFVNGCDASILLDDTTNFTGEKTAGANNNSIRGYEVIDTIKSHLESSCPGVVSCADILAIAARDSVVLGGPSWTVLLGRRDSTTASLTDANSDIPAPTLSLSDLITSFSNKGFTAKEMVALSGS
HTIGQARCTSFRTRLYNENDINATFATSLNANCPSSGGDNNLSPLDTTSPTYFDNAYFKNLQTQKGLLHSDQQLFSGGSTDAQVNTYSSNSATFMTDFANAMVTMGNLSPLTGSSGQIRK
NCRKVN

Retrieve as FASTA  
Remarks complete sequence from genomic (chromo 1, 3 introns). No prediction from Phytozome.
DNA ►
Send to BLAST
CDS►
Send to BLAST