Entry information : EgrPrx17
Entry ID 8179
Creation 2011-03-03 (Qiang Li)
Last sequence changes 2012-02-16 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EgrPrx17
Name EgrPrx17
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx17
start..stop
S start..stop
EgrPrx20 620 0 1..319 1..319
EgrPrx18 615 0 1..319 1..319
EcamPrx20 607 0 1..319 1..319
EguPrx17 599 0 1..319 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10528986..10529201 216 N° 2 10530266..10530457 192 N° 3 10530578..10530744 167 N° 4 10530861..10531242 382
join(10528986..10529201,10530266..10530457,10530578..10530744,10530861..10531242 )


exon

Literature and cross-references EgrPrx17
DNA ref. Phytozome 12:   scaffold_1 (10528986..10531242)
Protein sequence: EgrPrx17
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319
PWM (Da):   %s   33945.66  
PI (pH):   %s   7.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACESSSTRPAFLLLLCFLHGTASAQLSSTFYSTSCPSALSTIKSSVSSVVKNEARMGASLLRLHFHDCFVNGCDASILLDDTTNFTGEKNASPNANSMRGFEVIDTIESELESKCPGIVSCADFLAVVARNSIVALGGPSWTVSLGRRDSTTASQSAANISIPPPTLNLSGLISAFSNKDFTAKEMVALLGSHTISQARCLTFREHLYNENNIDTMFATSLKANCPSSGGDSKLFPFDTTSPTSFDDVFFKNL*THKVFLHSDQQLFSGGSTDVHVNAYSSNLSTFRTDFANAMVKMGNLSPLIGSSGQIRKNCRKV

Retrieve as FASTA  
Remarks Complete sequence frm genomic (chromo 1, 3 introns). Sequence contains a stop in frame due to Bad sequencing maybe. No prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCCACCAGACCAGCCTTCTTATTGTTGCTGTGTTTCCTCCATGGAACAGCCTCTGCTCAGCTGTCCAGTACTTTCTACTCCACCTCCTGTCCCAGCGCCCTC
TCCACCATCAAATCCAGCGTGAGCTCTGTGGTCAAAAACGAGGCCCGCATGGGCGCGTCCTTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GCAAGTCCCTCTGCTCTGAGTCTC
TCCTCTCTTTCCGATTGATTACTACCATTGTTTCTCTCCTTCATTCAAGCTGAATGCAAGCGAGCATGCATGATGCATCTTTGTGCCTACGCATGTGAAGCGTTCCATCCAACCACATAG
TCAAAAGAATCATTAGATTCGCTTCTGCGCAAGTTATCGTACTCTCTTTTTCACTAACCAAACAGTAGGTAGGAGGTTGACATATTGAATTAGTTGAGATTTTTGGTGCTTTCTTGTGTC
ATGCATTTTTGTGAGTTTATTATACCAATAATCAATTCTGTTTATTACAGCACAATAAGTTTTTTGGTAATTCGAAAAAACTTCATGATTATTTTTAGCATACATTGCCGGTGTAAAAAT
ATTTTTCACAATCAATCTTATCCACTCTTAATTTGCCAGTTAGTGAGAGATTTGGTAATTAGAATCCTCCAATTACGAATGACCAGGAATGATTATGTAAAATTTTCTTTACATTGATGG
TCTATGCTCTAATTTACACCGGAAAAAACTACGCAGCAGAGCGTACTTTGCGCTAACTATGCTGTTGATCAGATAAATGGGTATATAAATAACATTGGAGCTGGCAAAAACAGAGAGATG
GCCATTGCTTTTTATATCGGCGGTTGACTTTACTCGGTTATCACATTTGGCTAACCAATCAATTCTTTTCAAGAGATTTTGATCATATTATGATCACTTCACTGTGGCAGCGATATATTT
TTACATAAAAAGTGATATGGATGGTAAAGTATCATTTTTAATGAAATTTGATAACTCAATACTATTCTAAAATCGCACTAGATCTTTGAACAATCAAATCGTGCCTTTTGCATGGCCAAA
TTAGTTTGCTTTCACACAAATTCAAAGTGTCAATCTAAATTAACCAATCAATTTAGATTAGTATGTTCATAATGGGGGGGCAAACTATTTCAGTAAAGATTATAGCACTGTTTGCAACCA
TTAAATCTAATTAACTCCAATCGGATCAATTTTCTATCTAGAAGGACTGATTAACAACATGTGCAAAAAACATGAAATAGGGATGCGACGCGTCAATTTTATTGGACGACACTACGAACT
TCACCGGGGAGAAGAACGCCAGCCCGAATGCCAATTCCATGCGGGGATTCGAGGTAATCGACACAATCGAGTCCGAATTGGAGAGCAAGTGCCCCGGTATCGTGTCTTGTGCTGATTTTT
TAGCCGTCGTTGCACGAAACTCCATCGTTGCC
GTAAGTGCACATTTTCGTCTCAATTGTACTTATTAATTGTGACGAAAAAAATCACATGTTATGTTCCTCATGCTATATTAATACTAAC
ACGTATGGATTTGTTATTTATTTAAATTTTAGTTAGGTGGCCCTAGTTGGACAGTCTCCCTTGGAAGAAGAGACTCAACCACCGCAAGTCAAAGTGCTGCTAATATTAGCATTCCTCCCC
CAACTTTGAACCTTAGCGGCCTAATCTCTGCATTCTCTAACAAAGACTTCACAGCTAAAGAAATGGTGGCACTTTTAGG
TCATTGTTTCTATTTTATTTTATTTTTGGTTGCAATTTTTA
ATAAAGAGTAACAATAATGCTCGATCGATATACTAAAAATCAATTTACAAAAATTGTTCGACCATTGTTAACAAGGTCGCACACAATAAGTCAAGCCCGATGCCTGACTTTCCGGGAGCA
TCTTTACAACGAGAACAACATCGACACCATGTTCGCGACATCGCTGAAAGCAAATTGCCCGAGCTCCGGAGGCGACAGCAAACTCTTTCCTTTTGACACCACAAGCCCGACGTCTTTTGA
CGACGTCTTCTTCAAGAACTTGTAAACCCACAAGGTTTTTCTTCATTCGGACCAACAATTGTTCAGTGGTGGTTCCACGGATGTTCACGTGAATGCTTATAGTAGCAATTTGTCCACTTT
TAGGACAGATTTTGCTAACGCCATGGTGAAAATGGGTAACCTTAGCCCACTCATTGGCTCAAGCGGTCAGATTAGAAAGAATTGCAGGAAAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCCACCAGACCAGCCTTCTTATTGTTGCTGTGTTTCCTCCATGGAACAGCCTCTGCTCAGCTGTCCAGTACTTTCTACTCCACCTCCTGTCCCAGCGCCCTC
TCCACCATCAAATCCAGCGTGAGCTCTGTGGTCAAAAACGAGGCCCGCATGGGCGCGTCCTTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAAT
GGATGCGACGCGTCAATTTTATTG
GACGACACTACGAACTTCACCGGGGAGAAGAACGCCAGCCCGAATGCCAATTCCATGCGGGGATTCGAGGTAATCGACACAATCGAGTCCGAATTGGAGAGCAAGTGCCCCGGTATCGTG
TCTTGTGCTGATTTTTTAGCCGTCGTTGCACGAAACTCCATCGTTGCC
TTAGGTGGCCCTAGTTGGACAGTCTCCCTTGGAAGAAGAGACTCAACCACCGCAAGTCAAAGTGCTGCTAAT
ATTAGCATTCCTCCCCCAACTTTGAACCTTAGCGGCCTAATCTCTGCATTCTCTAACAAAGACTTCACAGCTAAAGAAATGGTGGCACTTTTAGG
GTCGCACACAATAAGTCAAGCCCGA
TGCCTGACTTTCCGGGAGCATCTTTACAACGAGAACAACATCGACACCATGTTCGCGACATCGCTGAAAGCAAATTGCCCGAGCTCCGGAGGCGACAGCAAACTCTTTCCTTTTGACACC
ACAAGCCCGACGTCTTTTGACGACGTCTTCTTCAAGAACTTGTAAACCCACAAGGTTTTTCTTCATTCGGACCAACAATTGTTCAGTGGTGGTTCCACGGATGTTCACGTGAATGCTTAT
AGTAGCAATTTGTCCACTTTTAGGACAGATTTTGCTAACGCCATGGTGAAAATGGGTAACCTTAGCCCACTCATTGGCTCAAGCGGTCAGATTAGAAAGAATTGCAGGAAAGTCAAC

Retrieve as FASTA