Entry information : SbPrx134 (Sobic.010G161600.1 [2.1] / SB10G021610 [1.4])
Entry ID 818
Creation 2006-01-04 (Christophe Dunand)
Last sequence changes 2006-01-04 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx134 (Sobic.010G161600.1 [2.1] / SB10G021610 [1.4])
Name (synonym) SbPrx134 (Sobic.010G161600.1 [2.1] / SB10G021610 [1.4])
Class Class III peroxidase    [Orthogroup: Prx127]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Cell culture
Embryos
Leaves
Roots
Inducers Abscissic acid treatment
Colletotrichum inoculation
Dark growth
Ethylene treatment
Heat shock stress
Light growth
Oxidative stress
Pathogen interaction
Phosphate starvation
Salt stress
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx134
start..stop
S start..stop
SbPrx135 602 0 1..314 1..313
ZmPrx48 576 0 1..314 1..313
SiPrx37 560 0 1..314 1..311
CciPrx01 499 1e-180 1..314 1..307
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47730540..47730746 207 N° 2 47730824..47731003 180 N° 3 47731143..47731700 558  
join(47730540..47730746,47730824..47731003,47731143..47731700)


exon

Literature and cross-references SbPrx134 (Sobic.010G161600.1 [2.1] / SB10G021610 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_10 (47730540..47731700)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.5842.1
Protein sequence: SbPrx134 (Sobic.010G161600.1 [2.1] / SB10G021610 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314 (292)
PWM (Da):   %s   33098.33 (30874.2)  
PI (pH):   %s   7.89 (7.98) Peptide Signal:   %s   cut: 23 range:23-314
Sequence 355
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPTLMQCLVAISLLSCVAHAQLSTTFYASSCPNLQSIVRRAMIQALSNDQRMGASLLRLFFHDCFVQGCDGSILLDAGGEKTAGPNANSARGFEVIDTIKTNVEAACPGVVSCADILALAARDGTNLLGGPTWNVPLGRRDSTTASASLANSNLPQSTASLGTLISLFSRQGLSARDMTALSGAHTIGQARCTTFRSRIYGDTNINASFAAALRQQTCPQSGGDGNLAPMDVQTPTRFDTDYYTNLLSQRGLFHSDQELFNGGSQDALVRQYSANPSLFNSDFMAAMIKMGNVGVLTGTAGQIRRNCRVVNS

Retrieve as FASTA  
Remarks Complete sequence from 154 ESTs and genomic (chromo 10, introns 1 and 2). Strongly expressed.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGCTCCTACCTTGATGCAATGCTTGGTCGCCATTTCCCTCCTCTCCTGTGTCGCCCACGCACAGCTCTCGACCACGTTCTATGCATCCTCCTGCCCCAACCTGCAGAGCATCGTGC
GGAGGGCGATGATCCAGGCCCTCAGCAATGACCAGAGGATGGGCGCCTCTCTGCTCAGGCTCTTCTTCCACGACTGCTTTGTTCAA
GTACTAGCCTAGAATCCTCACACTATTCATCAAG
TTCTCCGGCAACAGTAGGCAATAACAGTATGTGATGATGACAGGGTTGCGACGGCTCGATCCTTCTCGACGCCGGAGGGGAGAAGACGGCCGGCCCCAACGCCAATTCGGCGCGCGGCTT
TGAGGTCATCGACACCATCAAGACCAACGTGGAGGCCGCGTGCCCCGGCGTCGTGTCGTGCGCCGACATCCTTGCCCTTGCCGCGCGAGACGGAACCAATCTG
GTACGCACGCCTACTAG
TTCGTTCCTTTAATTACATGTCATATTCAGTTAGTTATCCGGTGTGTATAGTCGCGGTCAAGGGGAATATGACGACGCGTCTAACACTTATCCTTCGTTTCCTGTTGTCCGCACGTACAT
AGCTCGGCGGGCCGACCTGGAACGTGCCGCTGGGCCGGCGGGACTCGACGACGGCGAGCGCGTCCCTTGCCAACAGCAACCTCCCGCAGTCGACGGCGAGCCTGGGTACGCTCATCTCGC
TGTTCAGCAGGCAGGGCCTGTCGGCGCGCGACATGACGGCGCTGTCGGGCGCGCACACCATCGGGCAGGCCCGGTGCACCACCTTCCGCAGCCGCATCTACGGCGACACCAACATCAACG
CCTCCTTCGCGGCGGCGCTCCGGCAGCAGACGTGCCCGCAGTCCGGCGGCGACGGCAACTTGGCGCCCATGGACGTGCAGACGCCGACGAGGTTCGACACGGACTACTACACCAACCTGC
TGTCGCAACGGGGCCTGTTCCACTCGGACCAGGAGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGAGGCAGTACAGCGCCAACCCCTCGCTCTTCAACAGCGACTTCATGGCGGCCA
TGATTAAGATGGGCAACGTTGGGGTGCTAACCGGCACCGCCGGACAGATCAGGCGCAACTGCCGAGTCGTCAACAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGGCTCCTACCTTGATGCAATGCTTGGTCGCCATTTCCCTCCTCTCCTGTGTCGCCCACGCACAGCTCTCGACCACGTTCTATGCATCCTCCTGCCCCAACCTGCAGAGCATCGTGC
GGAGGGCGATGATCCAGGCCCTCAGCAATGACCAGAGGATGGGCGCCTCTCTGCTCAGGCTCTTCTTCCACGACTGCTTTGTTCAA
GGTTGCGACGGCTCGATCCTTCTCGACGCCGGAG
GGGAGAAGACGGCCGGCCCCAACGCCAATTCGGCGCGCGGCTTTGAGGTCATCGACACCATCAAGACCAACGTGGAGGCCGCGTGCCCCGGCGTCGTGTCGTGCGCCGACATCCTTGCCC
TTGCCGCGCGAGACGGAACCAATCTG
CTCGGCGGGCCGACCTGGAACGTGCCGCTGGGCCGGCGGGACTCGACGACGGCGAGCGCGTCCCTTGCCAACAGCAACCTCCCGCAGTCGACGG
CGAGCCTGGGTACGCTCATCTCGCTGTTCAGCAGGCAGGGCCTGTCGGCGCGCGACATGACGGCGCTGTCGGGCGCGCACACCATCGGGCAGGCCCGGTGCACCACCTTCCGCAGCCGCA
TCTACGGCGACACCAACATCAACGCCTCCTTCGCGGCGGCGCTCCGGCAGCAGACGTGCCCGCAGTCCGGCGGCGACGGCAACTTGGCGCCCATGGACGTGCAGACGCCGACGAGGTTCG
ACACGGACTACTACACCAACCTGCTGTCGCAACGGGGCCTGTTCCACTCGGACCAGGAGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGAGGCAGTACAGCGCCAACCCCTCGCTCT
TCAACAGCGACTTCATGGCGGCCATGATTAAGATGGGCAACGTTGGGGTGCTAACCGGCACCGCCGGACAGATCAGGCGCAACTGCCGAGTCGTCAACAGCTAG

Retrieve as FASTA