Entry information : EgrPrx01
Entry ID 8181
Creation 2011-03-04 (Qiang Li)
Last sequence changes 2011-03-04 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-05-16 (Qiang Li)
Peroxidase information: EgrPrx01
Name EgrPrx01
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus grandis    [TaxId: 71139 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EgrPrx01
start..stop
S start..stop
EcamPrx01 694 0 1..337 1..337
EgrPrx16 694 0 1..337 1..337
EcamPrx16 692 0 1..337 1..337
EglPrx16 691 0 1..337 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 390337..390579 243 N° 2 389970..390155 186 N° 3 389663..389822 160 N° 4 389122..389546 425
complement(join(389122..389546,389663..389822,389970..390155,390337..390579))


exon

Literature and cross-references EgrPrx01
DNA ref. Phytozome 12:   scaffold_1 (390579..389122)
Protein sequence: EgrPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (311)
PWM (Da):   %s   37331.52 (34370.9)  
PI (pH):   %s   6.39 (6.50) Peptide Signal:   %s   cut: 27 range:27-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRWGLLLLLSELALVSLCAVQHVEAAEGLEPPLTLKWHYYRNSCRDAETYVRHQVEYYWKPDKSLTPKLLRLLYSDCFVTGCDASILLDGRNSEKTAPQNSGLEGYGTVVIDKIKQVLEQRCPGVVSCADILNLAARDAAHLAGAPSYPVLTGRRDGMSSSKASVDLPSPSISWEEALAYFESRNLDVLDLATLLGAHSMGKTHCSYITYRLYNYNSTGKPDPDMDPSYLAQMRKQCPPNSKSQGDPQVFLDPASGSSYTFSNSYYSRLLNHQATLGIDQQLARGDDTSQIAQEYDAGLEDFRKEFALSMARMGNIKVLTGNQGEIRKNCRAVNSK*

Retrieve as FASTA  
Remarks Complete sequence from genomic. No prediction from phytozome. Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGTTGTCGGAGCTTGCGTTGGTGAGCTTGTGCGCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCCGCCGCTGACGCTGAAGTGGCACTAC
TACCGGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCCAAGCTCCTCCGACTGCTCTACTCTGACTGCTTCGTC
ACG
GTACGTATCGTCCGTTGTCATCGCTTTCATACCGAGTTTCAGTAGGCTTTCTGAGCTCTCGAAATGGGCTTTCTAACGCATAATAATGGTGGAAACCGGGCATGTACGTGCAATAAC
TTGTTTTTTTCTTTAATAAACAAAGCCTTGGATTGAGATACGTTTGGCTACCTGTGTAAAACAGGGCTGTGATGCGTCTATTCTGTTGGACGGGCGAAATTCAGAGAAAACAGCGCCACA
AAATTCAGGGCTTGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAACAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGC
CGCTCATTTG
GTAGGTGCCTGGTTTGCAGTTCTCTTCTTTGGCTTCAAAAGAGCTTATTTTCACTGCCCTACCGATCATTGAAATGCTGCTAGCTTGAACTTGTAGTATTAGATGTGAAA
AACCAGAATCGCTGACACGATAATGTTTTTCTCACAGGCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCGTCGTCCAAGGCGTCGGTGGACCTCCCGTCGCC
ATCCATCTCGTGGGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GTAAGATGGATCATTGTATAGAAAAGTAAATAATTGATTTGGA
CCTCATCAAGTCATCGCTTTTTGAAACATTAAAATCAATTCCTAACTTTGCCCGAAAATATGAAATTGGACAGGGGCTCATTCAATGGGCAAGACTCACTGCAGCTACATCACATACAGG
CTGTACAATTACAACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCAAACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTT
GACCCCGCCTCAGGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGACCAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATC
GCTCAGGAGTATGATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTGACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGA
GCCGTGAACAGCAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGTTGTCGGAGCTTGCGTTGGTGAGCTTGTGCGCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCCGCCGCTGACGCTGAAGTGGCACTAC
TACCGGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCCAAGCTCCTCCGACTGCTCTACTCTGACTGCTTCGTC
ACG
GGCTGTGATGCGTCTATTCTGTTGGACGGGCGAAATTCAGAGAAAACAGCGCCACAAAATTCAGGGCTTGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAA
CAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCCGCTCATTTG
GCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCG
TCGTCCAAGGCGTCGGTGGACCTCCCGTCGCCATCCATCTCGTGGGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GGGCTCATTCA
ATGGGCAAGACTCACTGCAGCTACATCACATACAGGCTGTACAATTACAACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCA
AACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTTGACCCCGCCTCAGGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGAC
CAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATCGCTCAGGAGTATGATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTG
ACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGAGCCGTGAACAGCAAATAA

Retrieve as FASTA