Entry information : SbPrx07 (Sobic.001G277000.1[2.1]Sb01g027330[1.4])
Entry ID 819
Creation 2005-12-29 (Christophe Dunand)
Last sequence changes 2005-12-29 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx07 (Sobic.001G277000.1[2.1]Sb01g027330[1.4])
Name (synonym) SbPrx07 (Sobic.001G277000.1[2.1]Sb01g027330[1.4])
Class Class III peroxidase    [Orthogroup: Prx068]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Seedlings
Inducers Colletotrichum inoculation
Dark growth
Drought
Oxidative stress
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx07
start..stop
S start..stop
ZmPrx31 602 0 1..338 2..340
SpPrx07 575 0 1..338 1..347
SiPrx147 512 0 25..338 25..341
SiPrx149 501 1.97e-180 1..338 1..342
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '819' 'join(46977047..46977280,46977447..46977644,46978277..46978439,46978568..46978989)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46977047..46977280 232 N° 2 46977447..46977644 196 N° 3 46978277..46978439 161 N° 4 46978568..46978989 420
join(46977047..46977280,46977447..46977644,46978277..46978439,46978568..46978989 )


exon

Literature and cross-references SbPrx07 (Sobic.001G277000.1[2.1]Sb01g027330[1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_1 (46977047..46978989)
Cluster/Prediction ref. PlantGDB:   SbGSStuc11-12-04.2192.1
Protein sequence: SbPrx07 (Sobic.001G277000.1[2.1]Sb01g027330[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (307)
PWM (Da):   %s   35947.86 (32963.3) Transmb domain:   %s   i12-31o
PI (pH):   %s   6.29 (5.30) Peptide Signal:   %s   cut: 32 range:32-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSPHHRAAVVAGVLLVVAAALCSRGAMAQLTADYYDCTCPDA
YNIVKNVLIEAHKSDVRIYASLTRLHFHDCFVQ
GCDGSVLLDALPGVANSTEKLAPANNNSARGFPVVDKVKAALENACPGVVSCADILALAAEISVELSGGPKWSVLLGRLDSKTANFKSAENLPSPFDNLTVLQQKFTAVGLHTVDLVALSGAHTFGRVQCQFVTSRLYNFSGTGRPDPTLNGGYRAFLTQRCPLNGNGSALNDLDPTTPNLFDNHYYTNLEVNRGFLNSDQELKSSPPAQGVTAPIVDQFASSQDAFFDNFAQSMINMGN
IQPLTDPSKGEVRCNCRVAN

Retrieve as FASTA  
Remarks TIGR database sequence from 18 EST. Complete genomic DNA (Predicted with Softberry) (3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCTAGCCCTCATCATCGTGCAGCCGTCGTCGCCGGCGTGCTGCTGGTGGTGGCGGCCGCCCTGTGCTCCCGCGGCGCCATGGCGCAGCTGACCGCGGACTACTACGACTGC
ACATGCCCTGACGCCTACAACATCGTGAAGAATGTGCTCATCGAGGCGCACAAGTCGGACGTGCGCATCTACGCCAGCCTCACCCGCCTCCATTTCCACGACTGCTTCGTCCAG
AGGTAA
CTACCATCAACAAACGATAGCCGCCATCATGCTTGCAATGTTCGTTCGGCTGATAAATCATGGCAGGAAATATTGTTGGCTAATTTGTTATAAGAAAAAAACACAGCTAATAAATTCAAG
CGAACAGGCTAACTTTTTGCCGTATCTGTTTGTCATCTTTAGGGCTGCGACGGCTCGGTGCTGTTGGACGCCTTGCCGGGGGTGGCCAACTCTACGGAGAAATTGGCGCCGGCGAACAAC
AACTCGGCGCGGGGGTTCCCGGTGGTGGACAAAGTGAAGGCGGCGCTGGAGAACGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCAGAGATCTCCGTCGAGCTG
TGGTACGTACGTAATAGGTGTCGGTAGTCTTACTAAACTATTCATGAAGATGGATGGATGCATAGCAGTGATGTGCGTAGAACTGGTAGGTTATCCGTAGTTTTCAACGGGCAACGGGCA
CATGCACATGCATGCCGGTTTAAGGTTTGAAAATAAAGTATGCTAGCTCATAATTAACTCCGTGTTGTTAGCACCTAATATCTATCAGGATACTTCAGTTCTACTAATTGGATCTTGGAC
TTCATCAGTTAATTACTACTACTAGCTAGTTCGGTAATGAGTATTTGAATTTTTTTCAATACGCAAAAAGGTTTGTGCACCATTGTATTAAGGTTGAGAAAGAAAGTTTTTACAACGACA
TGCCATGACACGTACGGGTGCCCTACTAGGAGGACCCTATGGTTTTACAATAAGCTTCTACACAGTAGGAACACGCATATCATGCCGACACAGATGCCAAACAAAAGGGTTTGTCGTGCT
GCAAACACAGGCCCCATATGCGCCTACTTTCTTGAACATGCAATGCATGCCGGGATCCATTATTGATCTAATACGACAACATACTACTGATCAGTGCCCATGCTCTGGCTAGACACCTGT
AACTAATTGATCTCGTTTCAATATGTACTTACAGTCCGGAGGCCCAAAGTGGAGCGTGCTTCTTGGGAGGCTAGACAGCAAGACGGCCAACTTCAAAAGCGCAGAGAACCTGCCGTCGCC
CTTCGACAACCTCACCGTGCTGCAGCAAAAGTTCACCGCCGTCGGCCTTCACACCGTCGACCTCGTCGCCCTCTCAG
AGGTATATATGGTGCCCATCAATCTCACATCGATCATTCACTG
CATGCTGTCGATCGACCGATTCACCAGCCATCAAACTTAACTCTGCTGTCTGCAATGCCTGCACAACACAACAACAAATGCATGCAGGGGCTCACACATTTGGCCGGGTGCAGTGCCAGT
TCGTGACGAGCCGGCTGTACAACTTCAGCGGCACCGGCCGGCCGGACCCTACGCTCAACGGCGGCTACCGGGCGTTCCTGACCCAGAGGTGCCCTCTGAACGGCAACGGGTCAGCCCTGA
ACGACTTGGATCCCACGACGCCCAACCTCTTCGACAACCACTACTACACCAACCTCGAGGTGAACCGAGGCTTCCTCAACTCCGATCAGGAGCTCAAGTCCTCGCCGCCGGCGCAGGGCG
TCACGGCGCCCATCGTCGACCAGTTCGCCAGCAGCCAGGACGCCTTCTTCGACAACTTCGCGCAGTCCATGATCAACATGGGCAACATTCAGCCACTCACGGACCCCTCCAAGGGAGAAG
TCCGCTGCAACTGCCGAGTGGCTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCTCTAGCCCTCATCATCGTGCAGCCGTCGTCGCCGGCGTGCTGCTGGTGGTGGCGGCCGCCCTGTGCTCCCGCGGCGCCATGGCGCAGCTGACCGCGGACTACTACGACTGC
ACATGCCCTGACGCCTACAACATCGTGAAGAATGTGCTCATCGAGGCGCACAAGTCGGACGTGCGCATCTACGCCAGCCTCACCCGCCTCCATTTCCACGACTGCTTCGTCCAG
GGCTGC
GACGGCTCGGTGCTGTTGGACGCCTTGCCGGGGGTGGCCAACTCTACGGAGAAATTGGCGCCGGCGAACAACAACTCGGCGCGGGGGTTCCCGGTGGTGGACAAAGTGAAGGCGGCGCTG
GAGAACGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCAGAGATCTCCGTCGAGCTG
TCCGGAGGCCCAAAGTGGAGCGTGCTTCTTGGGAGGCTAGACAGCAAG
ACGGCCAACTTCAAAAGCGCAGAGAACCTGCCGTCGCCCTTCGACAACCTCACCGTGCTGCAGCAAAAGTTCACCGCCGTCGGCCTTCACACCGTCGACCTCGTCGCCCTCTCAG
GGGCT
CACACATTTGGCCGGGTGCAGTGCCAGTTCGTGACGAGCCGGCTGTACAACTTCAGCGGCACCGGCCGGCCGGACCCTACGCTCAACGGCGGCTACCGGGCGTTCCTGACCCAGAGGTGC
CCTCTGAACGGCAACGGGTCAGCCCTGAACGACTTGGATCCCACGACGCCCAACCTCTTCGACAACCACTACTACACCAACCTCGAGGTGAACCGAGGCTTCCTCAACTCCGATCAGGAG
CTCAAGTCCTCGCCGCCGGCGCAGGGCGTCACGGCGCCCATCGTCGACCAGTTCGCCAGCAGCCAGGACGCCTTCTTCGACAACTTCGCGCAGTCCATGATCAACATGGGCAACATTCAG
CCACTCACGGACCCCTCCAAGGGAGAAGTCCGCTGCAACTGCCGAGTGGCTAATTAA

Retrieve as FASTA