Entry information : SbPrx50 (Sobic.003G024700.1 [2.1] / SB03G002370 [1.4])
Entry ID 833
Creation 2006-01-17 (Christophe Dunand)
Last sequence changes 2011-01-18 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx50 (Sobic.003G024700.1 [2.1] / SB03G002370 [1.4])
Name (synonym) SbPrx50 (Sobic.003G024700.1 [2.1] / SB03G002370 [1.4])
Class Class III peroxidase    [Orthogroup: Prx175]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Ovaries
Seedlings
Inducer Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx50
start..stop
S start..stop
ZmPrx119 521 0 1..337 1..342
SiPrx20 471 8e-169 15..337 6..321
OsPrx02 444 4e-158 32..337 16..317
OsPrx86 400 8e-141 36..337 32..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2129740..2129982 243 N° 2 2129440..2129634 195 N° 3 2128774..2129349 576  
complement(join(2128774..2129349,2129440..2129634,2129740..2129982))


exon

Literature and cross-references SbPrx50 (Sobic.003G024700.1 [2.1] / SB03G002370 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_3 (2129982..2128774)
Protein sequence: SbPrx50 (Sobic.003G024700.1 [2.1] / SB03G002370 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (303)
PWM (Da):   %s   34896.61 (31612.9)  
PI (pH):   %s   8.32 (7.98) Peptide Signal:   %s   cut: 35 range:35-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGPRSAMGCSSLPSSRALWLTTAVVAALAAGAQASLSPGFYDATCPGLQPIVRRVVARAVQMEPRMGASLLRLFFHDCFVNGCDASVLLDDVPGSFVGEKNAGPNANSLRGFEVIDAIKAQVEASCNATVSCADIVALAARDAVNLLGGPRWSVPLGRRDARNTSANAANANLPPPDASLPTLLSMFGAKGLDARDLTALSGAHTVGRARCVVFRSHIYNDTATTNATFAAELRSTVCPYTGGDANLAPLKLQAPDVFDNGYFRDLVTRRVLLRSDQALYDGGNGTTDALVRAYAANGTAFAADFAAAMVRMGNLGPPAGSAAAAATEVRLNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, introns 1 and 2) and 4 ESTs. Mix of ovaries of varying immature stages.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCCGCGGTCGGCGATGGGATGTTCGTCCTTGCCGTCCTCCCGTGCTCTGTGGCTCACGACGGCCGTCGTCGCGGCGCTCGCCGCCGGCGCGCAGGCGTCGCTGTCGCCGGGGTTC
TACGACGCGACGTGCCCGGGGCTGCAGCCCATCGTGCGCCGCGTCGTGGCGCGGGCCGTCCAGATGGAGCCGCGCATGGGGGCGTCCCTCCTCCGCCTCTTCTTCCACGACTGCTTCGTC
AAT
GTAAGACACACACTTGGGGTTTTTGGCTGCTGTTGCTGTTGGTCCTGGTCCTGAATCCTGGATGGTGATCGTGTGGTGTGTGCCGGCCGCCGGGTTCCCTCGCAGGGCTGCGACGCC
TCCGTCTTGCTGGACGACGTGCCCGGTAGCTTCGTCGGGGAGAAGAACGCGGGTCCCAACGCCAACTCGCTGCGCGGGTTCGAGGTCATCGACGCCATCAAGGCGCAGGTCGAGGCGTCC
TGCAACGCCACCGTCTCCTGCGCCGACATCGTCGCCCTCGCCGCGCGCGACGCCGTCAACCTG
GTCAGTGTTCAGCCGCTGCTCCGGTCTCTCTCTTTCCAAATTAAACAACCAACCAAA
CAACTGAGCGTGACCGCCGTGGCGAGAGTGCAGCTCGGTGGGCCGAGGTGGTCGGTGCCGCTAGGCCGGCGAGACGCGCGGAACACGAGCGCGAACGCGGCGAACGCCAACCTACCGCCG
CCGGACGCGAGCCTACCGACGCTGCTGTCCATGTTCGGCGCCAAGGGCCTGGACGCGCGGGACCTGACGGCGCTGTCGGGGGCGCACACGGTGGGGCGCGCCCGCTGCGTGGTGTTCCGC
TCCCACATCTACAACGACACGGCCACCACCAACGCCACCTTCGCGGCGGAGCTCCGGAGCACCGTCTGCCCCTACACGGGCGGCGACGCCAACCTGGCGCCGCTGAAGCTGCAGGCGCCC
GACGTCTTCGACAACGGCTACTTCCGGGACCTGGTCACCCGCCGCGTGCTGCTGCGGTCCGACCAGGCGCTGTACGACGGCGGCAACGGCACCACGGACGCGCTCGTGCGCGCCTACGCC
GCCAACGGGACGGCGTTCGCCGCCGACTTCGCCGCCGCCATGGTCAGGATGGGGAACCTGGGACCGCCTGCCGGGAGCGCCGCCGCCGCCGCCACCGAGGTCCGGCTCAACTGCCGGCGA
GTGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCCGCGGTCGGCGATGGGATGTTCGTCCTTGCCGTCCTCCCGTGCTCTGTGGCTCACGACGGCCGTCGTCGCGGCGCTCGCCGCCGGCGCGCAGGCGTCGCTGTCGCCGGGGTTC
TACGACGCGACGTGCCCGGGGCTGCAGCCCATCGTGCGCCGCGTCGTGGCGCGGGCCGTCCAGATGGAGCCGCGCATGGGGGCGTCCCTCCTCCGCCTCTTCTTCCACGACTGCTTCGTC
AAT
GGCTGCGACGCCTCCGTCTTGCTGGACGACGTGCCCGGTAGCTTCGTCGGGGAGAAGAACGCGGGTCCCAACGCCAACTCGCTGCGCGGGTTCGAGGTCATCGACGCCATCAAGGCG
CAGGTCGAGGCGTCCTGCAACGCCACCGTCTCCTGCGCCGACATCGTCGCCCTCGCCGCGCGCGACGCCGTCAACCTG
CTCGGTGGGCCGAGGTGGTCGGTGCCGCTAGGCCGGCGAGAC
GCGCGGAACACGAGCGCGAACGCGGCGAACGCCAACCTACCGCCGCCGGACGCGAGCCTACCGACGCTGCTGTCCATGTTCGGCGCCAAGGGCCTGGACGCGCGGGACCTGACGGCGCTG
TCGGGGGCGCACACGGTGGGGCGCGCCCGCTGCGTGGTGTTCCGCTCCCACATCTACAACGACACGGCCACCACCAACGCCACCTTCGCGGCGGAGCTCCGGAGCACCGTCTGCCCCTAC
ACGGGCGGCGACGCCAACCTGGCGCCGCTGAAGCTGCAGGCGCCCGACGTCTTCGACAACGGCTACTTCCGGGACCTGGTCACCCGCCGCGTGCTGCTGCGGTCCGACCAGGCGCTGTAC
GACGGCGGCAACGGCACCACGGACGCGCTCGTGCGCGCCTACGCCGCCAACGGGACGGCGTTCGCCGCCGACTTCGCCGCCGCCATGGTCAGGATGGGGAACCTGGGACCGCCTGCCGGG
AGCGCCGCCGCCGCCGCCACCGAGGTCCGGCTCAACTGCCGGCGAGTGAACTGA

Retrieve as FASTA