Entry information : RcAPx-R
Entry ID 8365
Creation 2011-05-09 (Christophe Dunand)
Last sequence changes 2011-05-09 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: RcAPx-R
Name RcAPx-R
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Ricinus
Organism Ricinus communis    [TaxId: 3988 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RcAPx-R
start..stop
S start..stop
MeAPx-R 499 9e-180 18..328 24..335
PtAPx-R 494 1e-177 19..328 27..337
VvAPx-R 454 3e-162 3..328 10..330
CclAPx-R 446 6e-159 11..328 19..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1023147..1023303 157 N° 2 1023494..1023608 115 N° 3 1023928..1024055 128 N° 4 1024624..1024694 71
N° 5 1024894..1024936 43 N° 6 1025029..1025125 97 N° 7 1025250..1025333 84 N° 8 1025501..1025622 122
N° 9 1025931..1025997 67 N° 10 1026291..1026393 103  
join(1023147..1023303,1023494..1023608,1023928..1024055,1024624..1024694,1024894 ..1024936,1025029..1025125,1025250..1025333,1025501..1025622,1025931..1025997,10 26291..1026393)


exon

Literature and cross-references RcAPx-R
DNA ref. Phytozome 12:   29848 (1023147..1026393)
EST ref. Galderia Genome:   EG662028.1 [5' end]
Protein sequence: RcAPx-R
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328
PWM (Da):   %s   35873.27  
PI (pH):   %s   8.76
Sequence 369
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHLLCFSAGPAPRWIMTLEFKFPSKSQHPYFSTIKSRAKPLQACSLSRNEDSGKDLDWVYTKRRIFISISTLPFLFHLHECFEGFGAKAAESDTTIYNLMKGEVRKVVSKGKAAGVLRLVFHDAGTFEMNGTSGGMNGSIVFELDRPENAGLKKSLKVVEKAKKEVDAIQPVSWADMIAVAGAEAVSVCGGPTIPVLLGRLDSGEPDAEGKLPEESLGASSLKQCFQRKGLSTQELVALSGAHTLGSKGFGNPTVFDNSYYKILLEKPWMSSAGMSSMIGLPSDRALVEDDECLRWIKKYADDQNTFFKDFKSAYIKLVNSGARWKSM

Retrieve as FASTA  
Remarks Complete sequence frpm genomic (9 introns) and 1 EST. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCATCTCTTGTGTTTTAGTGCCGGTCCGGCCCCGAGATGGATCATGACACTTGAATTCAAGTTTCCCTCTAAATCACAGCATCCCTATTTCTCGACGATCAAATCTCGAGCAAAACCTC
TCCAAGCTTGCAGCCTTTCAAGAAATGAGGACTCTG
GTAATCATCTTAGTGTTTAATTACTTAGTAAGCCAAGCAAATGAGAAAGAAAGATTCTCTTTTTGGCTAATTTGGTCTTTTTGG
TCCGTTTTTATTACTGTATGTTTAATTACTCAAAGAACTAAGCAGATGATAAGACAAGAATCTCTTTGGGACTTGATTTTTTCCTCTCTTTTTTTGGGGTCTGCAGGAAAAGATCTTGAC
TGGGTTTATACTAAAAGGAGAATCTTTATCAGTATATCTACACTACCGTTTCTATTTCATTTGCATGAATGCTTTGAAGGTTTTGGTGCCAAGGCAGCTGA
GTAAGTTAGCAAAATAGTT
ACTATGACTTTGAGTTGCTTTTTCTTTTATGTGTAAATTTTTATTTCAAGTTATAGTACTTGGCTTTAGTAGAGTTCAATATCTAGAAGTAGATTCCTCTTTAAATAATTCTATTGCTTT
CAAGGTTTATGTCTAGTGGAACTTCATCTTCAAAGACGTTCCTCAAGTTTTGACATGTAGCTTATATGCTTGTGGGCCTGATGTAGTGTATTTTTGTGCGTCCTTGTTCTTGTGGTGCCT
CTTAGTTGCTATACTTGTTAATTTACTCCCATAATTTTCTTTCCTTTCCTGATCTTAAAGGTCAGATACTACTATATATAATCTCATGAAGGGAGAAGTAAGGAAGGTAGTGTCCAAAGG
CAAGGCTGCTGGTGTACTTCGTCTTGTTTTTCATGATGCAGGAACCTTTGAAATGAATGGGACTTCAG
GTATTAATTTTGGAAATATGAAATTTTAGTGATCATAGTGTACATAATCTTT
ATCAGTTGTATTAAGGATTCACATCTTATGGTTCCATTAAATGTTTGCATTAACCTGTGTGATAAAGTGAAAGAAGTCAGCTTTAGGTTATGACCAAATTCTTATATAAGCTTTTATTGT
CTCGGGTATCCATAAGGATGTAGTTGAGAGAGATTCATGATAGTACTCATATTCATAAAGCATCTTCAGTCATGGCTATGGCTCTTTTACATAAACCACCTAACTACATAATGTGGGAGA
AGCAAGTCGAGCTTGAGATGGTTGAATTAATTGGCATTTGGTGCCATAAAAATGAGATCTCAACTTTAGTATAGGATTAGTGAATCTCTGTGCCAGATAATTTAAATATTTAGTTAATTT
TGCTCAGTTCAAGTTCATAGTGTATATCAACGTTGTGCACTGGAATCTGGTCTTTTTTTATTTCTTCTCATTTCCTCATTTCTTTACGTCCCCTCTTGGAAGTAATTTTGTTCTCTTAGG
CTTTTAACTTACTCTGCACTGTTGTTATTGTTGTAGGGGGGATGAATGGTTCTATAGTTTTTGAACTTGATAGGCCTGAAAATGCAGGTTTAAAGAAATCTTTGAAGGTATACCTCTGAC
TCTCTCTCAGGCTTCTATTCTTATAAACATAAACATGTAACCTGCTCTGATGTATATGCATGTGTTGCGACCATGTGCTCTCCTTCTTATTGTTCTACTTATGTGATTTTGTTCTCTAAT
TCAGACTGGTCAAATCTTATACAATCTCCCACCTGCTAACTCCAAAGTCGGTGCATTGTTGTTTAGGTTGTTGAGAAAGCAAAGAAGGAAGTGGATGCAATACAACCAGGTGGTTAAAAT
ATGGTGCAATGTTAAAGGTTTCAGCATTTGTTAGAGAGTGTGGGGCCTTCTTGATATCCTATTGGAGTTTTCCTTTTTTAGTATCCTGGGCGGACATGATTGCTGTGGCTGGAGCTGAAG
CTGTTTCGGTTTGTGGAGGTCCAACAATCCCAGTTTTACTGGGGAGGCTGGATTCAGG
GTATGTAAGAGATATTTAACTGTTGCCCTTACTATTTTAACATGGAATAAAACTTAAAATCA
GACAATTTAGAATACCTGCATAAATTTCTTGGCACCAATTACTAACAAGTAACTATTTACAGGGAGCCTGATGCGGAAGGAAAACTTCCTGAGGAGTCTCTGGGTGCTTCTAGTTTGAAG
CAATGCTTTCAAAGAAAAGGCTTATC
GTGAGTCTTCATCCATTCTTATTGAAATTTTATTCTAGAAGCTGATGACATATTTTCTGTATCCGTTGTTTACATAATTTTTTTTTTCATTAGT
AAGTTTTTGAATTGTAACCATAATTAAATATCAGATGATATTTTTTCTGAAGAAAACTAATTTACCTTTGCAGAACACAAGAACTGGTTGCATTATCTGGAGCTCATACTCTGGGGAGTA
AAGGCTTTGGAAACCCAACTGTTTTCGACAATTCTTACTATAAAATTCTTCTGGAAAAGCCATGGATGTCTTCAG
GTAAAGCTAACTTATTATCATCTTTTTGCCACTAGTTCTGTCTGC
ATTAGATAGTTGCCTTAAGATCTCAGATAGTTCAGTAGTATGTCAGCTGAGGGCACTGGTGTCCTTTAGTTACAGGCCTGAATCTATTCCAATATGAATTTTTTATATACATCAGGATTA
ATGATGCATATAGATAATCTAGAATGCGGGTAAAGCAAGCATCTTTAGTCAGAATGGAATGTGCTACATTTTGGTTCCTCTTTCTGAAAAATCTTAACATATATAGATGATTCCGTTTAA
CTGGATTCATTTTTCAATAGCAGCTGGAATGTCAAGCATGATTGGACTTCCTTCAGATCGTGCACTTGTCGAGGATGATGAATGCTTAAGGTTATTCATATACCAGAACCCCCCAATCAA
TCATTTTGCTAAGCACTCAGATATATTTTACACAGGTGTTATACAAAAAAAGTTCCATACTTCAACAACAATACAATAACCTGTATGCCCACGAAAACAAATCATAACTTGTAAACCAAT
TTCTTGCATCTTCCTCTCAATTCAGCATATGTAAGTTAGAACCTTCATGCATGTTTCCTGTAACTGAAAAGAAACTCATGAGTTCATGGAAAAAGCTTATTTTCCAGTTTCTCAGCTGAA
AGAGAACTCGTATTTTGATGCAGATGGATCAAAAAGTATGCTGATGATCAGAATACATTCTTTAAAGATTTCAAGAGTGCATACATCAAACTTGTGAATTCAGGTGCAAGATGGAAAAGC
ATGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCATCTCTTGTGTTTTAGTGCCGGTCCGGCCCCGAGATGGATCATGACACTTGAATTCAAGTTTCCCTCTAAATCACAGCATCCCTATTTCTCGACGATCAAATCTCGAGCAAAACCTC
TCCAAGCTTGCAGCCTTTCAAGAAATGAGGACTCTG
GAAAAGATCTTGACTGGGTTTATACTAAAAGGAGAATCTTTATCAGTATATCTACACTACCGTTTCTATTTCATTTGCATGAAT
GCTTTGAAGGTTTTGGTGCCAAGGCAGCTGA
GTCAGATACTACTATATATAATCTCATGAAGGGAGAAGTAAGGAAGGTAGTGTCCAAAGGCAAGGCTGCTGGTGTACTTCGTCTTGTTT
TTCATGATGCAGGAACCTTTGAAATGAATGGGACTTCAG
GGGGGATGAATGGTTCTATAGTTTTTGAACTTGATAGGCCTGAAAATGCAGGTTTAAAGAAATCTTTGAAGGTTGTTGAGA
AAGCAAAGAAGGAAGTGGATGCAATACAACCAG
TATCCTGGGCGGACATGATTGCTGTGGCTGGAGCTGAAGCTGTTTCGGTTTGTGGAGGTCCAACAATCCCAGTTTTACTGGGGAGGC
TGGATTCAGG
GGAGCCTGATGCGGAAGGAAAACTTCCTGAGGAGTCTCTGGGTGCTTCTAGTTTGAAGCAATGCTTTCAAAGAAAAGGCTTATCAACACAAGAACTGGTTGCATTATCTG
GAGCTCATACTCTGGGGAGTAAAGGCTTTGGAAACCCAACTGTTTTCGACAATTCTTACTATAAAATTCTTCTGGAAAAGCCATGGATGTCTTCAG
CTGGAATGTCAAGCATGATTGGAC
TTCCTTCAGATCGTGCACTTGTCGAGGATGATGAATGCTTAAG
ATGGATCAAAAAGTATGCTGATGATCAGAATACATTCTTTAAAGATTTCAAGAGTGCATACATCAAACTTGTGAATT
CAGGTGCAAGATGGAAAAGCATGTGA

Retrieve as FASTA