1. Browse the Database
  2. View Redoxidase
Entry information : SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Entry ID 838
Creation 2006-08-16 (Christophe Dunand)
Last sequence changes 2014-08-04 (Messaoudi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Name (synonym) SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Class Class III peroxidase    [Orthogroup: Prx148]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Seedlings
Inducers Heat shock stress
Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx72
start..stop		 S start..stop
ZmPrx67 534 0 24..321 25..320
SiPrx78 503 0 20..321 21..320
BdiPrx97 494 4.41e-178 5..321 7..324
TaPrx130-1A 464 2.67e-166 4..321 15..329
Gene structure Fichier Exons►


exon

Literature and cross-references SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Literature Cordonnier-Pratt, M.-M. et al., unpublished.
DNA ref. Phytozome 12:   chromosome_4 (9998074..10057581) [Sequencing error]
EST ref. GenBank:   CD204432.1 [5' end]  CN135146.1 [5' end]  CD204323.1 [3' end]  CN135065 [Fragment]
Cluster/Prediction ref. UniGene:   Sbi.20406
Protein sequence: SbPrx72 (Sobic.004G105200.1[2.1] / SB04G008600[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (298)
PWM (Da):   %s   32749.15 (30578.8) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.43 (4.30) Peptide Signal:   %s   cut: 24 range:24-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARRLLLLPALLVAAALAGGAGAQLSAGFYSSTCPTVESVVRQAMSQAVTNNTRTGAAMLRLFFHDCFVNGCDASLLLDDTPTTPGEKGAGANAGASTSGFDLIDTIKTQVEAACPATVS
CADILALAARDAVNLLGGPSWAVPLGRRDATFPNSTGAGTDLPGPDTDLDGLVAGFAAKGLTSRDLAALSGAHTVGMARCASFRTRVYCDDNVSPAFAAQQRGVCPVPAAGGDDALAPLD
SLTPDEFDNGYYRSLMTGAGLLHSDQELFNNEALDSLVRLYGTNADAFSSDFAASMVRLGNIAPLTGAAGEIRLNCRTVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 4 ESTs. Partial exon 4 due to the nnnn completed with ESTs.
DNA ►
Send to BLAST