Entry information : MtPrx[P]106 (Medtr2g029880.1 [4.0] / Medtr2g029880.1 [3.5] / AC234842_10.1 [3.0])
Entry ID 8458
Creation 2011-08-10 (Qiang Li)
Last sequence changes 2011-08-10 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Catherine Mathe
Last annotation changes 2016-05-17 (Catherine Mathe)
Peroxidase information: MtPrx[P]106 (Medtr2g029880.1 [4.0] / Medtr2g029880.1 [3.5] / AC234842_10.1 [3.0])
Name (synonym) MtPrx[P]106 (Medtr2g029880.1 [4.0] / Medtr2g029880.1 [3.5] / AC234842_10.1 [3.0])
Class Class III peroxidase     [Orthogroup: Prx043]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx[P]106
start..stop
S start..stop
MtPrx35 338 2e-117 9..237 112..353
MtPrx15 332 4e-115 18..237 122..352
MsPrx15 330 1e-114 18..237 123..353
GmPrx260 324 4e-112 17..236 117..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11185016..11185062 47 N° 2 11184835..11184889 55 N° 3 11184124..11184289 166 N° 4 11183403..11183857 455
complement(join(11183403..11183857,11184124..11184289,11184835..11184889,1118501 6..11185062))


exon

Literature and cross-references MtPrx[P]106 (Medtr2g029880.1 [4.0] / Medtr2g029880.1 [3.5] / AC234842_10.1 [3.0])
DNA ref. Phytozome 12:   chr2 (11185062..11183403)
Cluster/Prediction ref. Phytozome Gene 12:   31064317 [Incorrect prediction]
Protein sequence: MtPrx[P]106 (Medtr2g029880.1 [4.0] / Medtr2g029880.1 [3.5] / AC234842_10.1 [3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   240
PWM (Da):   %s   26186.29  
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNYLDPTNKLLIFIGCVVSCADILALGANISSVLAHGPDWEVPLGRRDSLNANQTLANLNLPRPQLNLTQLIFSFSKQGLNITDLVALSGAHTIGRGQCGFFVDRLYDLNNTKNPDPTLNTTYLQTLRTRCPNGVPMVEQDVTSYYSNLRIQKGLFQSDQELFSTPGADTIAIVNSFSSNQTLFFEAFKASMIKMGNIGVLTGTQGEVRTHCNFVNTVSLATKVTKDSAEDGIVSSYQVI*

Retrieve as FASTA  
Remarks Partial sequence from genomic. No EST found. Exon 1 and part of exon 2 are missing. Incorrect prediction from phytozome (predicted as complete).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTATCTTGACCCCACCAACAAATTGCTCATTTTCATTGGTTGGTGGGTAAATTACCTACCATTCTTCAAAGGTAATCTAGAAAAAACCCACTAATAGTAATACTATCGTGAGCGA
GCAAGGAGCTAGGCCAAATAAAAAACTCAATAAGGGCTGTGATTTTGTCCTAGTGTTGTGTCTTGTGCTGATATTCTTGCACTTGGTGCTAACATTTCCTCAGTTCTGGTATGTTCCACA
GATTCTAACTGAGACTTAAAACAAATTTTAATATATGTGACAGAATTTTTTTTAAATGAGTTGATAAATTTGTTATACAAGTCATTAGTATTGAAAGCCTCTTAGCCGGCCATCTTTGAT
GCTAGGTTTCTTCATAGTACTAAAAAAATGTCTGGGATTCCATCTGTAAGTAACTTGAAAGTTTCAACCTAAATATAAAAAGACCAATCAATTAAAATATATTATTTTAAGTTTCAACCT
TCATTTTTTTTTGTTATGGTTTAAGTTTTGGCAAATATACTACTTTTTATTTTTAGTTCTGTTTTTTTTTAATCCTACAAAATTTCTTCCTATTGTTGATTTTAGTCTTAATATAAAGAC
TAAAAGGAATATTTGACAAGTACCTCTAAAAAATGCCTTTCTTTAATTCCTTTTAATAAACTTTTTTTTTTCTCACGACTTATTATTATTACTACTACTTGTATTATTTTTTTCCTTTTC
TTATTTATTTTTTTGCTTGTGATTCTAATTTTTCTTGGTTACATAATTTGCAGGCTCATGGTCCTGATTGGGAAGTTCCATTAGGAAGAAGAGATAGTTTGAATGCAAATCAAACTCTTG
CTAATTTAAACCTTCCTCGTCCCCAATTGAATCTTACTCAGCTAATATTCTCCTTTTCTAAACAAGGTCTCAACATTACTGATCTTGTTGCACTTTCAG
GTATAAAAGTTTTGTCTCCTA
AAAAGCTATAGGTGTACGCAACATTAGTGTACATATATTTTTACATATATGCATGTGTGTCTTTTCTAAGTAAAAAGAATTGAAAAAGAGAAAATTAAAGTGGAAATAATATTAATCATT
TTTTCCCTATTTATGCACAATAACTAGACACATGTCTATTTATCCAAACCAATTACATTTTGCCAAGTGTATTTTCTCATATGCTATTTAGAATCATAACATAATGTTTTTTAAAAAAAA
ATTAGGTGCTCATACAATTGGTAGAGGTCAATGTGGATTCTTCGTTGATCGATTATACGATTTGAACAATACTAAAAATCCTGACCCAACTCTCAACACAACCTACTTACAAACATTGAG
AACAAGATGTCCCAATGGTGTCCCAATGGTGGAACAAGATGTCACAAGCTACTACTCAAACCTAAGGATTCAAAAGGGGTTGTTTCAGAGTGACCAAGAATTGTTTTCCACACCTGGTGC
TGATACCATTGCCATTGTTAATAGCTTTAGCAGCAATCAAACTCTTTTCTTTGAAGCTTTTAAGGCCTCCATGATTAAGATGGGTAATATTGGAGTGTTAACTGGAACTCAAGGTGAAGT
TAGAACACACTGTAACTTTGTTAATACTGTTAGTCTTGCTACCAAAGTCACCAAAGATTCAGCAGAAGATGGTATTGTTAGCTCATACCAAGTAATTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTATCTTGACCCCACCAACAAATTGCTCATTTTCATTGGTTGTGTTGTGTCTTGTGCTGATATTCTTGCACTTGGTGCTAACATTTCCTCAGTTCTGGCTCATGGTCCTGATTGG
GAAGTTCCATTAGGAAGAAGAGATAGTTTGAATGCAAATCAAACTCTTGCTAATTTAAACCTTCCTCGTCCCCAATTGAATCTTACTCAGCTAATATTCTCCTTTTCTAAACAAGGTCTC
AACATTACTGATCTTGTTGCACTTTCAG
GTGCTCATACAATTGGTAGAGGTCAATGTGGATTCTTCGTTGATCGATTATACGATTTGAACAATACTAAAAATCCTGACCCAACTCTCAAC
ACAACCTACTTACAAACATTGAGAACAAGATGTCCCAATGGTGTCCCAATGGTGGAACAAGATGTCACAAGCTACTACTCAAACCTAAGGATTCAAAAGGGGTTGTTTCAGAGTGACCAA
GAATTGTTTTCCACACCTGGTGCTGATACCATTGCCATTGTTAATAGCTTTAGCAGCAATCAAACTCTTTTCTTTGAAGCTTTTAAGGCCTCCATGATTAAGATGGGTAATATTGGAGTG
TTAACTGGAACTCAAGGTGAAGTTAGAACACACTGTAACTTTGTTAATACTGTTAGTCTTGCTACCAAAGTCACCAAAGATTCAGCAGAAGATGGTATTGTTAGCTCATACCAAGTAATT
TAA

Retrieve as FASTA