Entry information : MtPrx[P]115 (Medtr5g074700 [4.0].1 / Medtr5g074700 [3.5] / Medtr5g082670.1[3.0])
Entry ID 8461
Creation 2011-08-10 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Catherine Mathe
Last annotation changes 2016-05-09 (Catherine Mathe)
Peroxidase information: MtPrx[P]115 (Medtr5g074700 [4.0].1 / Medtr5g074700 [3.5] / Medtr5g082670.1[3.0])
Name (synonym) MtPrx[P]115 (Medtr5g074700 [4.0].1 / Medtr5g074700 [3.5] / Medtr5g082670.1[3.0])
Class Class III peroxidase     [Orthogroup: Prx012]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx[P]115
start..stop
S start..stop
MtPrx02 453 1.31e-163 1..231 92..322
MtPrx70 447 3.7e-161 1..231 92..322
MtPrx86 418 1.12e-149 1..231 92..322
GmPrx70 363 6.89e-128 1..230 94..325
Gene structure Fichier Exons


exon

Literature and cross-references MtPrx[P]115 (Medtr5g074700 [4.0].1 / Medtr5g074700 [3.5] / Medtr5g082670.1[3.0])
DNA ref. Phytozome 12:   chr5 (31749185..31750140)
Cluster/Prediction ref. Phytozome Gene 12:   31088108 [Incorrect prediction]
Protein sequence: MtPrx[P]115 (Medtr5g074700 [4.0].1 / Medtr5g074700 [3.5] / Medtr5g082670.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   230
PWM (Da):   %s   25502.17  
PI (pH):   %s   10.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
PNINSIRSFEVVDQIKAAVTKACKRDVVSCADILAIAARDSVAILGGKQYWYQVLLGRRDSRFASRDAANTNLPPPFFNFSQLIKNFKSHGLNLKDLVVLSGGHTIGFSKCTNFRNRIYN
DTNIDKKFAANLQKTCPQIGGDNNLAPFDSTPNKVDTSFYKALLYKRGLLHSD*ELFKGDGSQSDRLVQLYSKNSYAFAYDFGVSMIKMGNLKPLTGKKGEIRCNCRKVNK

Retrieve as FASTA  
Remarks Pseudogene. Incorrect prediction from Phytozome (Exon 1 and part of exon 2 are missing).
DNA
Send to BLAST
CDS
Send to BLAST