Entry information : MtPrx107 (Medtr3g105790.1[4.0] / Medtr3g105790.1[3.5] / x)
Entry ID 8464
Creation 2011-08-10 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: MtPrx107 (Medtr3g105790.1[4.0] / Medtr3g105790.1[3.5] / x)
Name (synonym) MtPrx107 (Medtr3g105790.1[4.0] / Medtr3g105790.1[3.5] / x)
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx107
start..stop
S start..stop
MtPrx114 666 0 1..324 1..324
GmPrx151 514 0 1..322 1..325
GmPrx295 496 1e-178 1..322 1..329
GmPrx67 488 2e-175 1..322 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 48802876..48803085 210 N° 2 48801776..48801955 180 N° 3 48801518..48801683 166 N° 4 48800474..48800892 419
complement(join(48800474..48800892,48801518..48801683,48801776..48801955,4880287 6..48803085))


exon

Literature and cross-references MtPrx107 (Medtr3g105790.1[4.0] / Medtr3g105790.1[3.5] / x)
DNA ref. Phytozome 12:   chr3 (48803085..48800474)
Cluster/Prediction ref. Phytozome Gene 12:   31055370
Protein sequence: MtPrx107 (Medtr3g105790.1[4.0] / Medtr3g105790.1[3.5] / x)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   35427.56 (32924.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   4.57 (4.55) Peptide Signal:   %s   cut: 24 range:24-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METTKSMFLFIAVSILFVSSVTANLAFDFYAASCPTAELFIRNAVSTSSSNDPSIPGKLLRMVFHDCFVEGCDASLMLQGNNTEQSDPGNRSVGGFSVIETAKRVLEMFCPGTVSCADIIALAARDAVEIAGGPRVQIPTGRRDGMVSIASNVRPNIVDTSFTMDEMLKLFSSKGLSLLDLVVLSGAHTIGTAHCNTFRGRFQQDRNGSLRLIDQTIDTNYADQLIKQCPINAQPSVAVNIDPETSMLFDNQYYRNLLDRKVLFQSDSVLMNNDDTRKLVEDFANDQELFFDNWGVSFVKLTSIGVKTDEEGEIRRSCAATNIV

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACAACAAAATCAATGTTTCTTTTCATAGCAGTTTCTATCTTGTTTGTTTCCTCTGTAACTGCTAATCTTGCTTTCGACTTCTATGCTGCTTCATGTCCAACAGCAGAGTTATTC
ATAAGAAATGCAGTCAGTACATCCTCTTCAAATGATCCTTCCATTCCTGGAAAGCTCCTTCGCATGGTTTTCCATGATTGCTTCGTAGAG
GTTAGTATTCAAATGTTGCTCTTCACCAAG
CAAATGACATTCTGTGAGAGTTTATAGAAACAAGTTATGCCATGTGCATAAGCTCTCTTAAATAGCTTATAAAAACGGTTTGACTTTATTTATCTTTTTATAAAGATAGCTTATACAATT
GCACTTATACGATACTCCCTCCGTCCCATAATATAAACAAAAAAAACGCAATTTCTTTGTCCCAAAATATAAGAAGAAAAAAAAAACAAACTTTTATCTTTTTCAAGATTTTTTTTTTTG
TTTATTCTCATAAAAGTAAATGCAAATTACATTCAATTTTCTCTCTCTTTCATTTTTTTCTATGACGAATAGATAAAAATTTGTGATATAAGCGCTTAATTAAATTGTTTGGATCCAAAC
AAGACTACTTGATGTGAGATTCAAATTGGTTTTATCTTGATAGATCTTTGTTATTTCCTCCGAATCAGTCCATGCATCACATGTTTTGATTCTAAGTGTTGGGTTGTTTTGACTTTTGAG
AGTTTCATATTGACTAGAGATATGACTTAGATAGTGCTTGTTAGGTTTGAGCAGTCCGGATCCAACAAGTCATTTTGTAGGATTTTGTCACACTCAATGTCAGAATTCTAAGATTTGAAG
TTCTGATGACCTTAGAGGTTGCATGCAATAGTGAGCTATGAACCACTAATACGATGTGTCGAGTGTCCAATACGTGTCGGTCTTTGACACTGACACGACATGCATGTGGATACACTCAAT
CACTTCAATTTTCTCAAATTATCAACTTCAGTGTCATGTTTGTTGCATCTATGTTAGTGCTTTATAGATAGTGAGGTATCATAATCGGGTACTCTGCACTTTATTTTTTACATTGGTTTA
TCAATTATGATTGTCTCCTTGATGCAATAAGATTATTATTTGAAATGCAGGGATGTGATGCATCTTTGATGCTACAAGGGAATAATACAGAACAAAGTGATCCAGGAAACAGATCTGTTG
GTGGATTTTCTGTTATAGAAACAGCGAAAAGAGTTCTTGAGATGTTCTGCCCAGGAACTGTTTCTTGTGCAGACATAATTGCTCTAGCAGCTAGAGATGCAGTTGAAATT
GTAAGTTCTC
CATTGCACTTCTTATACTATCCTTCAATCAGAAATAGACATGTCTTTTTGGTACTGTTGTTGAAAGACACTTTGTGAAACAGGCTGGTGGACCAAGGGTTCAGATTCCTACAGGTAGGAG
AGATGGAATGGTTTCAATTGCTTCAAATGTTAGACCCAACATTGTGGACACTAGTTTTACTATGGACGAGATGCTTAAGCTCTTTTCCAGTAAAGGATTGTCCTTACTTGATCTTGTGGT
TCTTTCAG
GTTCATAATATAAACCCAAATCTATATCTATATTATTTACATTTTAGAATTTACCAAGACTTGAACATAGTACTAGTATTTTTTTTTTTTATTTCAAGTAAAATTCCATAAA
GTAACACATTTTGGTCGGTAGAAATAATTAAACTATAGATGCTTTGTAGATGATATCATCTAATCAAATTTGTTATAATTGCCATCTTGACATGTTGAGAGTACTACGTTGGATAGTAAT
ATGATCTGAACGATGATTATAGTTGAAGGCAACCGTCATTCCATGTAGTAGTTTTTGAGGTTGAACAAAGAATTATAATTCTGATATGGTAAACAAAGTATAGCCTATTGAGCCATCCAC
ATATATCTAGTAGTTTATACACTCCAGATGTCTAGTCTCTGGCTTGAGGAATGTGTTGAGAGTCCTTCAAGCCGGTTTTTTGAATATTTTGAGTCCGGTCCAATTTTTAAAACATTAGTT
GGCCTATTTCTCTTTCTAACTTTTGGGTATTCAAACCAAGTGTATTAGACAAAAATATCTCATGCTTTATTTGATTGTCTGCTTCTTCTCACTATATTTACTTTAATATCTAACTAGTGT
TACATATTTAGTACTAATTGTTAAGCTTTGCAGGGGCTCATACAATAGGAACAGCTCATTGCAATACATTCAGGGGTCGTTTCCAACAAGACAGAAATGGAAGTCTTAGGCTCATTGACC
AAACCATTGATACTAATTATGCTGATCAGCTAATAAAACAGTGTCCAATAAATGCACAACCATCCGTGGCAGTGAACATCGATCCTGAAACATCTATGCTATTTGACAACCAATACTACA
GAAATCTTCTTGATCGCAAAGTTCTGTTCCAGTCTGATTCGGTTTTGATGAACAATGATGACACGAGGAAACTAGTGGAGGATTTTGCAAATGATCAAGAACTTTTCTTTGACAATTGGG
GTGTGTCGTTCGTAAAGCTAACCAGTATTGGGGTAAAAACTGACGAGGAGGGTGAAATTCGACGTTCTTGTGCTGCAACTAATATTGTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACAACAAAATCAATGTTTCTTTTCATAGCAGTTTCTATCTTGTTTGTTTCCTCTGTAACTGCTAATCTTGCTTTCGACTTCTATGCTGCTTCATGTCCAACAGCAGAGTTATTC
ATAAGAAATGCAGTCAGTACATCCTCTTCAAATGATCCTTCCATTCCTGGAAAGCTCCTTCGCATGGTTTTCCATGATTGCTTCGTAGAG
GGATGTGATGCATCTTTGATGCTACAAGGG
AATAATACAGAACAAAGTGATCCAGGAAACAGATCTGTTGGTGGATTTTCTGTTATAGAAACAGCGAAAAGAGTTCTTGAGATGTTCTGCCCAGGAACTGTTTCTTGTGCAGACATAATT
GCTCTAGCAGCTAGAGATGCAGTTGAAATT
GCTGGTGGACCAAGGGTTCAGATTCCTACAGGTAGGAGAGATGGAATGGTTTCAATTGCTTCAAATGTTAGACCCAACATTGTGGACACT
AGTTTTACTATGGACGAGATGCTTAAGCTCTTTTCCAGTAAAGGATTGTCCTTACTTGATCTTGTGGTTCTTTCAG
GGGCTCATACAATAGGAACAGCTCATTGCAATACATTCAGGGGT
CGTTTCCAACAAGACAGAAATGGAAGTCTTAGGCTCATTGACCAAACCATTGATACTAATTATGCTGATCAGCTAATAAAACAGTGTCCAATAAATGCACAACCATCCGTGGCAGTGAAC
ATCGATCCTGAAACATCTATGCTATTTGACAACCAATACTACAGAAATCTTCTTGATCGCAAAGTTCTGTTCCAGTCTGATTCGGTTTTGATGAACAATGATGACACGAGGAAACTAGTG
GAGGATTTTGCAAATGATCAAGAACTTTTCTTTGACAATTGGGGTGTGTCGTTCGTAAAGCTAACCAGTATTGGGGTAAAAACTGACGAGGAGGGTGAAATTCGACGTTCTTGTGCTGCA
ACTAATATTGTATAA

Retrieve as FASTA