Entry information : AcoAPx02 (AcoGoldSmith_v1.009479m-test)
Entry ID 8466
Creation 2011-08-12 (Christophe Dunand)
Last sequence changes 2011-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoAPx02 (AcoGoldSmith_v1.009479m-test)
Name (synonym) AcoAPx02 (AcoGoldSmith_v1.009479m-test)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoAPx02
start..stop
S start..stop
AfpAPx03 586 0 1..288 1..288
BnAPx03-1Aa_other 475 8e-172 1..288 1..287
GhAPx01 474 2e-171 1..288 1..288
NtAPx05-1A 473 4e-171 1..288 1..287
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6845609..6845721 113 N° 2 6847429..6847553 125 N° 3 6848701..6848750 50 N° 4 6849847..6849912 66
N° 5 6849984..6850032 49 N° 6 6852107..6852189 83 N° 7 6852280..6852359 80 N° 8 6852474..6852576 103
N° 9 6853440..6853637 198  
join(6845609..6845721,6847429..6847553,6848701..6848750,6849847..6849912,6849984 ..6850032,6852107..6852189,6852280..6852359,6852474..6852576,6853440..6853637)


exon

Literature and cross-references AcoAPx02 (AcoGoldSmith_v1.009479m-test)
DNA ref. Phytozome 12:   scaffold_6 (6845609..6853637)
Protein sequence: AcoAPx02 (AcoGoldSmith_v1.009479m-test)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   288
PWM (Da):   %s   31624.57 Transmb domain:   %s   o259-281i
PI (pH):   %s   7.8
Sequence 329
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATPIVDAEYLKEIDKARRDLRALISSKNCAPIMLRLAWHDAGTYDVNTKTGGANGSIRNDEELKHSANSGLKIAIDLLEPVKKRHPKITYADLYQLAGVVAVEVTGGPTIEFVPGRKDSKVSPNEGRLPDAKKGVQHLRDIFYRMGLSDKDIVALSGAHTLGRAHPERSGFEGAWTSEPLKFDNNYFVELLKGEAEGLLKLPTDKALLDDPEFRKYVELYAKDEDAFFRDYAASHKKLSELGFTPSFSGPKLDIKTGTILVQSAVGVAVAAAVVALSYFYEVHRRIK

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAACTCCTATTGTTGATGCAGAATACCTTAAGGAAATTGACAAAGCTCGTCGTGATCTTCGAGCTCTTATTTCTAGCAAGAATTGTGCTCCCATTATGCTTCGTTTAGCGTAATTTT
TTTTTCCCTCTTCTCCCTTTTTTTTTTCTTTCTGTTTGAAAATTAATATCTTCGACTTCAGCTATTTTCGATTAATTAGTTCCCTTCTCCCTTCTTAAAATAGGTATCTGTAATCCTCAT
TTATTTCATCTTTGCGCTATGTTGGTTAAGAATTAATTAATACAGTGATTTGATCATGAGTGTCACAACCTCACTATTGGGTGGTCACAACCTCACTATGGGCGAGGCTATATGGAACGA
CGACATTACTATGCCTTATTATTATGTGTAGTCACTGTTGGTGTGATTCAATACTGAGGGACGACTAGGGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTACCATCAGAGTGTCAATAGAGACAGTATCTTGATTTTTGGAATGGTAGGATTTTAGGATCTAGGTTTATGCAATTAGTTTTCTGCATC
ATGCACTTCAGACTTTCATTGAGTATTAGATTGTGCTTAACATCTACCTAATGTTTATGTAGAATTTCAAATTATATGGATAACTTAGTGTCTCAAAAATCTGAAAATACTGGCATTATA
TATTGGTTTTGGATTACACCCTATACTAATAATATCTGCATCATTCCCAAGGTTGTGTCTGTGGACTCTCAATTTATCAACAGTGATGGGTGTGATTTTTGAGATCATATGGATATTTTA
AGTCATTGGTCATTGGTAGTGTACCTATCTGTTGAGGAAAAATAGGACGCTGCCATACTATCAAAATTATTTAGCCATCAGCCAATGCAAACTTTTACCATGATCTCATTTTCAATCAGG
ATATGCAAACTTTTCAACGACATTTTTCTCTTTCCAATCTTCTGAAATTGCTCCCTTTTCAGCTTACTAATGGTGAACACCAGCACCAACAACTAAATTGATGTACACTACATAATATTT
TTTTTTTGTTATTTTACAGGTGGCATGATGCAGGAACTTACGATGTTAACACCAAAACAGGTGGTGCAAATGGCTCAATTAGGAATGACGAGGAGTTGAAACACAGTGCAAACAGTGGCT
TGAAAATAGCAATAGATCTCTTGG
GTGAGTATTGCATCAAATCTGTATGTTCGATGAGTCTTAACTTAGTCCCTTTTTTGCTCTATTGGTGTAACTGGAAACATTGCAAATCTGAATTTT
GCTTTTGTGGTGTAACGTTGAAACAATTTTGAACTCAGAACAGACAAGATGACATCCCTAGGATATTAACCTTCAGATCACCCATCCCTTTCATGAAGCTTTTGTANNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNGAACTTATATTCTTTATTGAAAGCTGAGTATGGGAATATGTACATTTAGTGTGTCAATGTAATACAAATTACAAACAAGTGTCTCACTCTTAGGCAGTTATC
CTTATTGGTAACCTTAATTATCTACAGAATAAATATAACATTAGTAGAATTCTCGTGCATTTGTTGTCGTCTTGTCGATATACCTAGACTCTGCAAGCCCGTATGCTTTCGTTTTTCTGT
AAATATTTTGCCTCTAAGTAGAACTTTATTTATGTTAATAATTTTTACAAGCCAAGTAGATTGAGTGAGAGAGGTCCTCTTTCAACTAGATTATAAGAAATGAATAACAGAACAATGGAA
AGCAAACTAAAATACAAAGATCAAAGACGCCAATAGTACTCAGGGAAATTATAGTGCTGTGTATTTTTTTTCTTGGTTAACCACTTTTATTTGGTTTTTTACCACCCTATAACTTGAAAC
TCTCCCATGCTCTCCACTGCCCCTGCGCAAACTTTCCCCAAAATTAGCCATTAAGGTTGTTGAGGGTGGTAACTACCTCTCCCCCACACCTTCAGAACATGTGCTTTTCTTTTCTTAATA
CGCACAAACCAATAATCTGAATGTTGCAGTCTATAGGTACAAATCCACTCAAAGCACAGGCAGGGGATGGTTTCTAAACTTAATTGGAATTTCGATTTGATTATATTTACAAGTGGTTGT
AAGAATCTTTTATTTAACAAGACATCTCAAAATATCATATTCTTTCTGTGCATCCTGAAGATATTTTTCTTTATATAAAACAGCGTGACCTTCTGACCTTTGGGTTTTCTAAATTTTTAT
ATTATATAACATATCCTTTGATTCTTAATTCGAATTGAATTTAGTAAACTAACTTTGTTCACTGATGCGTTAATAATTTTTTCAACATCAGAGCCAGTGAAGAAAAGGCATCCGAAGATT
ACTTATGCAGATCTTTACCAG
GTGATGCATCTTTCTTATGATACTTTTAAAATGATGTTTTCATAATTCATAGATTATCATCTTTCGTTTTTTATTTTAATTAGAAACTTCATTTATGTC
CATATAATATAAATCGTCATGGTATGCCTAAGATTTTACGGCCTGCTCCAAAAGATAAATCGGGACACAGATCCACTAGAATTCTTAAAAAATATACTGAATTATTGAATATTCTTTGTG
CTGTATTCTTTGTTCATAGCAAATAGCAATTTGTATTAATTTTTTTGGATCCAGTGTTTAAAAATACCCATGGAGGTGCGCAACTCGAGGTGCAGCTCACACTTTTTGGACCCAAAACGT
ACTGCGGCTATAGCCTTGCAGGCATAATAAAATGCTTACGTCTCTGTCCACTGAGGGGCACACACTGAAGGGATAGTATCGAGGTGGTTTGAGGCAATGCAAGAAGATAAATACAGAATT
TTATAAACTTGAGAAAGCCTACACATAATTTCGAGATAGAATATTAACAAAATAGTTACTGCTAGTATGAAAGAACTCAACACCATATAGGGCTATATGCAACACTGAAGGAGACAATGA
GCAGAGGATATGTTCTTTAGGGGTTTAGGTGAATTAATAATGAAAAACAAAAATGAAAACCACCATAAGTCTTGCATGTGCAACCTGCTGCGAAGAAGATGAAGAAGAAAGAGAGAATGA
GAGAGTTTCTTGAGCGTTTTAACTAGAGACGGTTTGGTGAGAAAAAGCCTTTTTTTTTATTGAAAAATTGTTTAATACGAGAGTTTGAATACCATAAATTATATTCATTTATAAGCAAAC
ACATCCATTGTGTAAAATGTAATATTTTTTTAGTGTTTTCTATCTCCAAATATGAAATGAAAATGCCAAACTATGTGGAAACTTGAGCTTTTTACTTTATAAATGTTTTTGCTGAAATTT
GGACTCTACCCTAACGTACATCAGCAACTAGTATCTTAGGGAAGCTGTAATAGTCTTCAGTTTTTGCAAGAATCATTTTTCTGCAACTATGTAAAGCTTGATTTTAAACTTAATCAGTCN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTAGCTTGCTGGAGTTGTTGCGGTTGAGGTCACTGGAGGGCCCACCATTGAGTTTGTTCCTGGTAGAAAGGTATGCAATTTGGCTTT
TGATCGCAACTACTTCACTGCTGCTGGTGAATCACACATTGTCGCTTTCTTCAGGATTCAAAGGTATCTCCCAATGAGGGGCGACTTCCAGATGCTAAAAAAGGTATCAAATATTCTATG
ATACTCCCTAACACACATGGTTGTTTAATTTGACATTATAAAGTTGGTTACTCCATCTTGCTTGCACATTTGTTTAGAACCTATGATGGCAGCAAAACGTAATCATAACTGCTGGCCAAA
AACATAGCTTATATATTTCACATGCGAAGATTACATAGAGTGACCTTTGCATAACACTTCTGTGATATGCTTGGGGTGAATCGCTAAATCCCTTGCCCTGCAATAACACTTGTGTATTTA
TGCAAATCCTCTAAGCTGTTAAGAAATGACAGCTTGTTTGTGTGGTAATGGTAGTGTACTGCAATGAAGTAAAACGTGAGATAATTACTCTTATACTCATTGCCATCTTTATTTTAAAAA
ATGCTATTCACTAATTCAATAATCTGTTGCATTTATCCGACCAAACAAGTTACTCGTGTGTCATGCATGTCACTACGACGACAGGATGCAAAACACTAGAGCAGTAGAGCTGTCTGTCCC
AAGGGTTCAATGCTTTTACAGGGTTAGTAGACAGCTATAAAACCTTCTAGACATGGCAGTAGGTATCCATCGAATGATCAAAGCAGTGTTACCTCGTTACTATCTCTGCAATTTGCTTTA
TCTCATGTGAATTTCTTTTTCTTTTTATCTGGAGGCAATTTAACCATGTTGCATTTAGCCGACCAAAAAAGTTACTAGTGTGTTATACACGTCACTTCGAAGACAGAATGAACACCTACT
AGAGCAGTAGAGCTGTCTTCTTCAGGGAGTTGATGTGCTTTTCAGGGTTAGTGCTACCATTAGTTTTTAGTAGACAACTATGATACCGTTCTAGACATGACATTAGATCTCCCTCAAGGG
TTAGGGTGCCCGTTACTATCTCTGCAATTTGCTTCATCTCATGTGAATTTCTTTTCTTTTTATATCTGCAACAACTCAGTACCATTATCATCCAGGGAATCTACCTTGCAACCCCATGGG
GATGGACGAAAACTTTGTATAAAAAAATAAGAAACATGGGAGAAATCAGAGATATTTCTGATTTCAAGGGCACACAATGTCTGAAAGTCTTATGAATTCTTCATATAAGTAGTCATCTAT
AATATGTTTCCTCTATAGGCATTATTGGCAAACCTATTCCTCTTTTCAATTGTATCAATAGCTAGGTCTTCTAAAAACATTAACTTTTCTGTTCAGTGTAAGTCTTGTTAGCCATCCATC
TGAATGCTCGCATCTCTAATATATTCAACCATTGTTTTTTAATCTGTTGAATATCCATTCACATTACTATTATGTGAATTAACTTAGTACGCCACTCGAAGACACCAGTGCTTTTTATCC
GTTGGGGTCGAATCTTATGCACAACAGTCTGATTGATCCCTCAATGAACAAAGGACTTATGATGAAATAGTTACTCCTTGGGAAATATTGGCCATCTGTTTTATGGTGCATCACTATTGT
TGCAGATTATAACCTAACCTTGTCTTGTAAATCTCTAAAGGGGTTTTTTTGTTCTTTTTGTTAGGTGAAGTTTTCTAATAAGTTTTAATTTTGCATTCATTCATTTTTAACACCTCGAAC
CTAGGCATTCACTCCAAGCACAAAATTATCATAAGGAAAAGGAAATACAGCCAAGATGCTGATATTACTATAGAATATAGATCAAGGGTGTACACATCTAGCATCTCCATTTGTTCATAT
TTAGGTTTGATAGCCTATTGGTTGTTTGTTTTCGAATGGCTGAGATACTGTGAAAGGTTGATATACTTTGTACTTACCACCAAACTGTGCCAGGTATCTGATGTAGTATATCATCAATTT
TATGTATTAAGTTAGATAAATGGGTAGAACAGAAGCTGCTTTGATTAGTACTCAAATTAGTAGTACTATTAAGTTACACATGTGCAGGCCTTTGTGTTTTGTTAGAGATTTAATAACCCA
ATCATTTTCATTAATTGTTTGATGACTTTCAAGTGTCTCCCCGCACCCCCAGTGATGTTTCTTGTTTTGGGAAAGTCTATTCTGGAAATTATTTGGGTCCTTTCTTGTTATATTTTTAAA
CGTGTGCGTGGTTTCAGGTGTACAACACTTGCGTGACATCTTCTATAGGATGGGTCTATCTGACAAGGATATTGTAGCATTGTCTGGAGCCCACACCTTGGTAACTATCTTGATCATACA
TAACCATCTCCATTTGTGTTCAATGCATAATGTATTTGAATTTGAATTTGTTTTTTTTTTTGCAATGCAGGGAAGGGCACATCCCGAGAGATCGGGTTTTGAAGGTGCTTGGACTAGTGA
ACCTTTGAAATTTGACAACAACTATTTTGT
GTAAGATTCAATAGGAACTGCCTTATTTTCCATTGTAACTTTCATATATGTTTTCAAGAATACTGAAGAGAATATCCAGAATTCATATCT
TACTATTATAGTGTGTACTAATAGGGAGCTTCTGAAAGGAGAAGCAGAGGGACTATTGAAACTGCCCACAGACAAGGCTCTACTGGACGATCCGGAGTTTCGTAAATATGTTGAACTTTA
TGCAAAG
GTAACTTCACATGCCCTTTCATGGTAAATTGTTGAGAAGGATCACACTTGCATAAAGTAGGAGTTATTTTCGATTTCATTGATCCTTAAAGAGTCTGAGGGCTGAGGCCACTT
TCACCTGTGCAACTGAGTTAAATTGCTTGCTCTTGTCCTAGCCTTTATTCCATATAGTTCTTGTGCCAACACTCATCTGGATCTTGCTCCACCCATACATACTGAACCCTGATTGTCTCT
AGTTAGTCTTCCAAAACCTTGCCTCTCCAACCTACCATCAGTTTTCAGTTTGAAGATGCCTTCATTGGATTTAACCCATTTGCATATCGAATGTTTGTTAGATGCAAATTTGAATACCAA
ATTTCCCTTACTGATCTGGCGGCAGCATTGAATTTGGATATGTTCCCTCACACGTGTTATGATTCTAAGTGTCACCTGGTTCTTACTTCGACTGCATACGCCTTCTGTAGTTTCGTTCTT
TCTATAGCAAATCCATTGTTGCACTCACAAAAGCTTTCAGCTTCTTGCTACTCCTTTGAACATAGTTTTAGGACTTGTATAAACTGCATAACAGCAATGCACCACCTAATCATTGAATGG
ACTTTTGTGGAAACTGAGCGCCCGTAGAGGTGACCGAAATAATAAAGGAATAATATATTATGTTTTGGACAAAATATAAGACCTTAACCTTAAAAAAAATGAGAAACGAAACATTACAGT
AAGGAGTTCTTATTTATTATGTAGGTTTTGGATTATAGGAAATCCATGTCAATCATCTGAATGATATGGGTATATGTCCAAAGTCCTATATGGTTTCATACCCAGTGCTAGATATTATTT
AACCAAGTTTCTTGGCTTTTGCAATGGCAGGATGAAGATGCTTTTTTCAGAGATTATGCAGCATCGCACAAGAAACTTTCTGAACTGGGATTCACGCCAAGTTTCTCAGGTCCCAAGCTG
GATATAAAGACTGGTACTATATTGGTACAAAGTGCTGTGGGGGTTGCAGTTGCAGCCGCAGTGGTTGCCTTGAGTTACTTCTACGAAGTTCACAGAAGAATCAAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAACTCCTATTGTTGATGCAGAATACCTTAAGGAAATTGACAAAGCTCGTCGTGATCTTCGAGCTCTTATTTCTAGCAAGAATTGTGCTCCCATTATGCTTCGTTTAGCGTGGCATG
ATGCAGGAACTTACGATGTTAACACCAAAACAGGTGGTGCAAATGGCTCAATTAGGAATGACGAGGAGTTGAAACACAGTGCAAACAGTGGCTTGAAAATAGCAATAGATCTCTTGG
AGC
CAGTGAAGAAAAGGCATCCGAAGATTACTTATGCAGATCTTTACCAG
CTTGCTGGAGTTGTTGCGGTTGAGGTCACTGGAGGGCCCACCATTGAGTTTGTTCCTGGTAGAAAGGATTCAA
AGGTATCTCCCAATGAGGGGCGACTTCCAGATGCTAAAAAAG
GTGTACAACACTTGCGTGACATCTTCTATAGGATGGGTCTATCTGACAAGGATATTGTAGCATTGTCTGGAGCCCACA
CCTTG
GGAAGGGCACATCCCGAGAGATCGGGTTTTGAAGGTGCTTGGACTAGTGAACCTTTGAAATTTGACAACAACTATTTTGTGGAGCTTCTGAAAGGAGAAGCAGAGGGACTATTGA
AACTGCCCACAGACAAGGCTCTACTGGACGATCCGGAGTTTCGTAAATATGTTGAACTTTATGCAAAG
GATGAAGATGCTTTTTTCAGAGATTATGCAGCATCGCACAAGAAACTTTCTG
AACTGGGATTCACGCCAAGTTTCTCAGGTCCCAAGCTGGATATAAAGACTGGTACTATATTGGTACAAAGTGCTGTGGGGGTTGCAGTTGCAGCCGCAGTGGTTGCCTTGAGTTACTTCT
ACGAAGTTCACAGAAGAATCAAGTAA

Retrieve as FASTA