Entry information : AcoAPx02 (AcoGoldSmith_v1.009479m-test)
Entry ID 8466
Creation 2011-08-12 (Christophe Dunand)
Last sequence changes 2011-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoAPx02 (AcoGoldSmith_v1.009479m-test)
Name (synonym) AcoAPx02 (AcoGoldSmith_v1.009479m-test)
Class Ascorbate peroxidase    [Orthogroup: APx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoAPx02
start..stop
S start..stop
AfpAPx03 586 0 1..288 1..288
PnodAPx13 478 6.21e-173 4..286 5..285
BnAPx03-1Aa_other 475 8.01e-172 1..288 1..287
GhAPx01 474 1.83e-171 1..288 1..288
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8466' 'join(6845609..6845721,6847429..6847553,6848701..6848750,6849847..6849912,6849984..6850032,6852107..6852189,6852280..6852359,6852474..6852576,6853440..6853637)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6845609..6845721 111 N° 2 6847429..6847553 123 N° 3 6848701..6848750 48 N° 4 6849847..6849912 64
N° 5 6849984..6850032 47 N° 6 6852107..6852189 81 N° 7 6852280..6852359 78 N° 8 6852474..6852576 101
N° 9 6853440..6853637 196  
join(6845609..6845721,6847429..6847553,6848701..6848750,6849847..6849912,6849984 ..6850032,6852107..6852189,6852280..6852359,6852474..6852576,6853440..6853637)


exon

Literature and cross-references AcoAPx02 (AcoGoldSmith_v1.009479m-test)
DNA ref. Phytozome 12:   scaffold_6 (6845609..6853637)
Protein sequence: AcoAPx02 (AcoGoldSmith_v1.009479m-test)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   288
PWM (Da):   %s   31624.57 Transmb domain:   %s   o259-281i
PI (pH):   %s   7.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATPIVDAEYLKEIDKARRDLRALISSKNCAPIMLRLAWHDAGTYDVNTKTGGANGSIRNDEELKHSANSGLKIAIDLEPVKKRHPKITYADLYLAGVVAVEVTGGPTIEFVPGRKDSKV
SPNEGRLPDAKK
GVQHLRDIFYRMGLSDKDIVALSGAHTGRAHPERSGFEGAWTSEPLKFDNNYFVELLKGEAEGLLKLPTDKALLDDPEFRKYVELYADEDAFFRDYAASHKKLSELGF
TPSFSGPKLDIKTGTILVQSAVGVAVAAAVVALSYFYEVHRRIK*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTCCTATTGTTGATGCAGAATACCTTAAGGAAATTGACAAAGCTCGTCGTGATCTTCGAGCTCTTATTTCTAGCAAGAATTGTGCTCCCATTATGCTTCGTTTAGCGCGTAAT
TTTTTTTTCCCTCTTCTCCCTTTTTTTTTTCTTTCTGTTTGAAAATTAATATCTTCGACTTCAGCTATTTTCGATTAATTAGTTCCCTTCTCCCTTCTTAAAATAGGTATCTGTAATCCT
CATTTATTTCATCTTTGCGCTATGTTGGTTAAGAATTAATTAATACAGTGATTTGATCATGAGTGTCACAACCTCACTATTGGGTGGTCACAACCTCACTATGGGCGAGGCTATATGGAA
CGACGACATTACTATGCCTTATTATTATGTGTAGTCACTGTTGGTGTGATTCAATACTGAGGGACGACTAGGGAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTACCATCAGAGTGTCAATAGAGACAGTATCTTGATTTTTGGAATGGTAGGATTTTAGGATCTAGGTTTATGCAATTAGTTTTCTGC
ATCATGCACTTCAGACTTTCATTGAGTATTAGATTGTGCTTAACATCTACCTAATGTTTATGTAGAATTTCAAATTATATGGATAACTTAGTGTCTCAAAAATCTGAAAATACTGGCATT
ATATATTGGTTTTGGATTACACCCTATACTAATAATATCTGCATCATTCCCAAGGTTGTGTCTGTGGACTCTCAATTTATCAACAGTGATGGGTGTGATTTTTGAGATCATATGGATATT
TTAAGTCATTGGTCATTGGTAGTGTACCTATCTGTTGAGGAAAAATAGGACGCTGCCATACTATCAAAATTATTTAGCCATCAGCCAATGCAAACTTTTACCATGATCTCATTTTCAATC
AGGATATGCAAACTTTTCAACGACATTTTTCTCTTTCCAATCTTCTGAAATTGCTCCCTTTTCAGCTTACTAATGGTGAACACCAGCACCAACAACTAAATTGATGTACACTACATAATA
TTTTTTTTTTGTTATTTTACAGGTGGCATGATGCAGGAACTTACGATGTTAACACCAAAACAGGTGGTGCAAATGGCTCAATTAGGAATGACGAGGAGTTGAAACACAGTGCAAACAGTG
GCTTGAAAATAGCAATAGATCTCTTGG
GGGTGAGTATTGCATCAAATCTGTATGTTCGATGAGTCTTAACTTAGTCCCTTTTTTGCTCTATTGGTGTAACTGGAAACATTGCAAATCTGA
ATTTTGCTTTTGTGGTGTAACGTTGAAACAATTTTGAACTCAGAACAGACAAGATGACATCCCTAGGATATTAACCTTCAGATCACCCATCCCTTTCATGAAGCTTTTGTANNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNGAACTTATATTCTTTATTGAAAGCTGAGTATGGGAATATGTACATTTAGTGTGTCAATGTAATACAAATTACAAACAAGTGTCTCACTCTTAGGCAG
TTATCCTTATTGGTAACCTTAATTATCTACAGAATAAATATAACATTAGTAGAATTCTCGTGCATTTGTTGTCGTCTTGTCGATATACCTAGACTCTGCAAGCCCGTATGCTTTCGTTTT
TCTGTAAATATTTTGCCTCTAAGTAGAACTTTATTTATGTTAATAATTTTTACAAGCCAAGTAGATTGAGTGAGAGAGGTCCTCTTTCAACTAGATTATAAGAAATGAATAACAGAACAA
TGGAAAGCAAACTAAAATACAAAGATCAAAGACGCCAATAGTACTCAGGGAAATTATAGTGCTGTGTATTTTTTTTCTTGGTTAACCACTTTTATTTGGTTTTTTACCACCCTATAACTT
GAAACTCTCCCATGCTCTCCACTGCCCCTGCGCAAACTTTCCCCAAAATTAGCCATTAAGGTTGTTGAGGGTGGTAACTACCTCTCCCCCACACCTTCAGAACATGTGCTTTTCTTTTCT
TAATACGCACAAACCAATAATCTGAATGTTGCAGTCTATAGGTACAAATCCACTCAAAGCACAGGCAGGGGATGGTTTCTAAACTTAATTGGAATTTCGATTTGATTATATTTACAAGTG
GTTGTAAGAATCTTTTATTTAACAAGACATCTCAAAATATCATATTCTTTCTGTGCATCCTGAAGATATTTTTCTTTATATAAAACAGCGTGACCTTCTGACCTTTGGGTTTTCTAAATT
TTTATATTATATAACATATCCTTTGATTCTTAATTCGAATTGAATTTAGTAAACTAACTTTGTTCACTGATGCGTTAATAATTTTTTCAACATCAGAGCCAGTGAAGAAAAGGCATCCGA
AGATTACTTATGCAGATCTTTACCAG
AGGTGATGCATCTTTCTTATGATACTTTTAAAATGATGTTTTCATAATTCATAGATTATCATCTTTCGTTTTTTATTTTAATTAGAAACTTCAT
TTATGTCCATATAATATAAATCGTCATGGTATGCCTAAGATTTTACGGCCTGCTCCAAAAGATAAATCGGGACACAGATCCACTAGAATTCTTAAAAAATATACTGAATTATTGAATATT
CTTTGTGCTGTATTCTTTGTTCATAGCAAATAGCAATTTGTATTAATTTTTTTGGATCCAGTGTTTAAAAATACCCATGGAGGTGCGCAACTCGAGGTGCAGCTCACACTTTTTGGACCC
AAAACGTACTGCGGCTATAGCCTTGCAGGCATAATAAAATGCTTACGTCTCTGTCCACTGAGGGGCACACACTGAAGGGATAGTATCGAGGTGGTTTGAGGCAATGCAAGAAGATAAATA
CAGAATTTTATAAACTTGAGAAAGCCTACACATAATTTCGAGATAGAATATTAACAAAATAGTTACTGCTAGTATGAAAGAACTCAACACCATATAGGGCTATATGCAACACTGAAGGAG
ACAATGAGCAGAGGATATGTTCTTTAGGGGTTTAGGTGAATTAATAATGAAAAACAAAAATGAAAACCACCATAAGTCTTGCATGTGCAACCTGCTGCGAAGAAGATGAAGAAGAAAGAG
AGAATGAGAGAGTTTCTTGAGCGTTTTAACTAGAGACGGTTTGGTGAGAAAAAGCCTTTTTTTTTATTGAAAAATTGTTTAATACGAGAGTTTGAATACCATAAATTATATTCATTTATA
AGCAAACACATCCATTGTGTAAAATGTAATATTTTTTTAGTGTTTTCTATCTCCAAATATGAAATGAAAATGCCAAACTATGTGGAAACTTGAGCTTTTTACTTTATAAATGTTTTTGCT
GAAATTTGGACTCTACCCTAACGTACATCAGCAACTAGTATCTTAGGGAAGCTGTAATAGTCTTCAGTTTTTGCAAGAATCATTTTTCTGCAACTATGTAAAGCTTGATTTTAAACTTAA
TCAGTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTTAGCTTGCTGGAGTTGTTGCGGTTGAGGTCACTGGAGGGCCCACCATTGAGTTTGTTCCTGGTAGAAAGAGGTATGCAA
TTTGGCTTTTGATCGCAACTACTTCACTGCTGCTGGTGAATCACACATTGTCGCTTTCTTCAGGATTCAAAGGTATCTCCCAATGAGGGGCGACTTCCAGATGCTAAAAAAGAGGTATCA
AATATTCTATGATACTCCCTAACACACATGGTTGTTTAATTTGACATTATAAAGTTGGTTACTCCATCTTGCTTGCACATTTGTTTAGAACCTATGATGGCAGCAAAACGTAATCATAAC
TGCTGGCCAAAAACATAGCTTATATATTTCACATGCGAAGATTACATAGAGTGACCTTTGCATAACACTTCTGTGATATGCTTGGGGTGAATCGCTAAATCCCTTGCCCTGCAATAACAC
TTGTGTATTTATGCAAATCCTCTAAGCTGTTAAGAAATGACAGCTTGTTTGTGTGGTAATGGTAGTGTACTGCAATGAAGTAAAACGTGAGATAATTACTCTTATACTCATTGCCATCTT
TATTTTAAAAAATGCTATTCACTAATTCAATAATCTGTTGCATTTATCCGACCAAACAAGTTACTCGTGTGTCATGCATGTCACTACGACGACAGGATGCAAAACACTAGAGCAGTAGAG
CTGTCTGTCCCAAGGGTTCAATGCTTTTACAGGGTTAGTAGACAGCTATAAAACCTTCTAGACATGGCAGTAGGTATCCATCGAATGATCAAAGCAGTGTTACCTCGTTACTATCTCTGC
AATTTGCTTTATCTCATGTGAATTTCTTTTTCTTTTTATCTGGAGGCAATTTAACCATGTTGCATTTAGCCGACCAAAAAAGTTACTAGTGTGTTATACACGTCACTTCGAAGACAGAAT
GAACACCTACTAGAGCAGTAGAGCTGTCTTCTTCAGGGAGTTGATGTGCTTTTCAGGGTTAGTGCTACCATTAGTTTTTAGTAGACAACTATGATACCGTTCTAGACATGACATTAGATC
TCCCTCAAGGGTTAGGGTGCCCGTTACTATCTCTGCAATTTGCTTCATCTCATGTGAATTTCTTTTCTTTTTATATCTGCAACAACTCAGTACCATTATCATCCAGGGAATCTACCTTGC
AACCCCATGGGGATGGACGAAAACTTTGTATAAAAAAATAAGAAACATGGGAGAAATCAGAGATATTTCTGATTTCAAGGGCACACAATGTCTGAAAGTCTTATGAATTCTTCATATAAG
TAGTCATCTATAATATGTTTCCTCTATAGGCATTATTGGCAAACCTATTCCTCTTTTCAATTGTATCAATAGCTAGGTCTTCTAAAAACATTAACTTTTCTGTTCAGTGTAAGTCTTGTT
AGCCATCCATCTGAATGCTCGCATCTCTAATATATTCAACCATTGTTTTTTAATCTGTTGAATATCCATTCACATTACTATTATGTGAATTAACTTAGTACGCCACTCGAAGACACCAGT
GCTTTTTATCCGTTGGGGTCGAATCTTATGCACAACAGTCTGATTGATCCCTCAATGAACAAAGGACTTATGATGAAATAGTTACTCCTTGGGAAATATTGGCCATCTGTTTTATGGTGC
ATCACTATTGTTGCAGATTATAACCTAACCTTGTCTTGTAAATCTCTAAAGGGGTTTTTTTGTTCTTTTTGTTAGGTGAAGTTTTCTAATAAGTTTTAATTTTGCATTCATTCATTTTTA
ACACCTCGAACCTAGGCATTCACTCCAAGCACAAAATTATCATAAGGAAAAGGAAATACAGCCAAGATGCTGATATTACTATAGAATATAGATCAAGGGTGTACACATCTAGCATCTCCA
TTTGTTCATATTTAGGTTTGATAGCCTATTGGTTGTTTGTTTTCGAATGGCTGAGATACTGTGAAAGGTTGATATACTTTGTACTTACCACCAAACTGTGCCAGGTATCTGATGTAGTAT
ATCATCAATTTTATGTATTAAGTTAGATAAATGGGTAGAACAGAAGCTGCTTTGATTAGTACTCAAATTAGTAGTACTATTAAGTTACACATGTGCAGGCCTTTGTGTTTTGTTAGAGAT
TTAATAACCCAATCATTTTCATTAATTGTTTGATGACTTTCAAGTGTCTCCCCGCACCCCCAGTGATGTTTCTTGTTTTGGGAAAGTCTATTCTGGAAATTATTTGGGTCCTTTCTTGTT
ATATTTTTAAACGTGTGCGTGGTTTCAGGTGTACAACACTTGCGTGACATCTTCTATAGGATGGGTCTATCTGACAAGGATATTGTAGCATTGTCTGGAGCCCACACCTTGTGGTAACTA
TCTTGATCATACATAACCATCTCCATTTGTGTTCAATGCATAATGTATTTGAATTTGAATTTGTTTTTTTTTTTGCAATGCAGGGAAGGGCACATCCCGAGAGATCGGGTTTTGAAGGTG
CTTGGACTAGTGAACCTTTGAAATTTGACAACAACTATTTTGT
GTGTAAGATTCAATAGGAACTGCCTTATTTTCCATTGTAACTTTCATATATGTTTTCAAGAATACTGAAGAGAATAT
CCAGAATTCATATCTTACTATTATAGTGTGTACTAATAGGGAGCTTCTGAAAGGAGAAGCAGAGGGACTATTGAAACTGCCCACAGACAAGGCTCTACTGGACGATCCGGAGTTTCGTAA
ATATGTTGAACTTTATGCAAAG
AGGTAACTTCACATGCCCTTTCATGGTAAATTGTTGAGAAGGATCACACTTGCATAAAGTAGGAGTTATTTTCGATTTCATTGATCCTTAAAGAGTCT
GAGGGCTGAGGCCACTTTCACCTGTGCAACTGAGTTAAATTGCTTGCTCTTGTCCTAGCCTTTATTCCATATAGTTCTTGTGCCAACACTCATCTGGATCTTGCTCCACCCATACATACT
GAACCCTGATTGTCTCTAGTTAGTCTTCCAAAACCTTGCCTCTCCAACCTACCATCAGTTTTCAGTTTGAAGATGCCTTCATTGGATTTAACCCATTTGCATATCGAATGTTTGTTAGAT
GCAAATTTGAATACCAAATTTCCCTTACTGATCTGGCGGCAGCATTGAATTTGGATATGTTCCCTCACACGTGTTATGATTCTAAGTGTCACCTGGTTCTTACTTCGACTGCATACGCCT
TCTGTAGTTTCGTTCTTTCTATAGCAAATCCATTGTTGCACTCACAAAAGCTTTCAGCTTCTTGCTACTCCTTTGAACATAGTTTTAGGACTTGTATAAACTGCATAACAGCAATGCACC
ACCTAATCATTGAATGGACTTTTGTGGAAACTGAGCGCCCGTAGAGGTGACCGAAATAATAAAGGAATAATATATTATGTTTTGGACAAAATATAAGACCTTAACCTTAAAAAAAATGAG
AAACGAAACATTACAGTAAGGAGTTCTTATTTATTATGTAGGTTTTGGATTATAGGAAATCCATGTCAATCATCTGAATGATATGGGTATATGTCCAAAGTCCTATATGGTTTCATACCC
AGTGCTAGATATTATTTAACCAAGTTTCTTGGCTTTTGCAATGGCAGGATGAAGATGCTTTTTTCAGAGATTATGCAGCATCGCACAAGAAACTTTCTGAACTGGGATTCACGCCAAGTT
TCTCAGGTCCCAAGCTGGATATAAAGACTGGTACTATATTGGTACAAAGTGCTGTGGGGGTTGCAGTTGCAGCCGCAGTGGTTGCCTTGAGTTACTTCTACGAAGTTCACAGAAGAATCA
AGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTCCTATTGTTGATGCAGAATACCTTAAGGAAATTGACAAAGCTCGTCGTGATCTTCGAGCTCTTATTTCTAGCAAGAATTGTGCTCCCATTATGCTTCGTTTAGCGTGGCAT
GATGCAGGAACTTACGATGTTAACACCAAAACAGGTGGTGCAAATGGCTCAATTAGGAATGACGAGGAGTTGAAACACAGTGCAAACAGTGGCTTGAAAATAGCAATAGATCTCTTGG
AG
CCAGTGAAGAAAAGGCATCCGAAGATTACTTATGCAGATCTTTACCAG
CTTGCTGGAGTTGTTGCGGTTGAGGTCACTGGAGGGCCCACCATTGAGTTTGTTCCTGGTAGAAAGGATTCA
AAGGTATCTCCCAATGAGGGGCGACTTCCAGATGCTAAAAAAG
GTGTACAACACTTGCGTGACATCTTCTATAGGATGGGTCTATCTGACAAGGATATTGTAGCATTGTCTGGAGCCCAC
ACCTTG
GGAAGGGCACATCCCGAGAGATCGGGTTTTGAAGGTGCTTGGACTAGTGAACCTTTGAAATTTGACAACAACTATTTTGTGGAGCTTCTGAAAGGAGAAGCAGAGGGACTATTG
AAACTGCCCACAGACAAGGCTCTACTGGACGATCCGGAGTTTCGTAAATATGTTGAACTTTATGCAAAG
GATGAAGATGCTTTTTTCAGAGATTATGCAGCATCGCACAAGAAACTTTCT
GAACTGGGATTCACGCCAAGTTTCTCAGGTCCCAAGCTGGATATAAAGACTGGTACTATATTGGTACAAAGTGCTGTGGGGGTTGCAGTTGCAGCCGCAGTGGTTGCCTTGAGTTACTTC
TACGAAGTTCACAGAAGAATCAAGTAA

Retrieve as FASTA