Entry information : MpiCIIAC01
Entry ID 8480
Creation 2011-08-24 (Christophe Dunand)
Last sequence changes 2011-08-24 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-05-22 (Christophe Dunand)
Peroxidase information: MpiCIIAC01
Name MpiCIIAC01
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Mycosphaerellaceae Mycosphaerella
Organism Mycosphaerella pini (Dothistroma septosporum )    [TaxId: 64363 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MpiCIIAC01
start..stop
S start..stop
CfulCIIAC01 459 3e-164 1..319 13..329
MfiCIIAC02 399 1e-140 1..319 1..318
MfiCIIAC01 351 8e-122 35..318 39..307
ZcelCIIAC02 322 8e-110 17..318 71..356
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2362754..2363402 649 N° 2 2363459..2363662 204 N° 3 2363713..2363819 107  
join(2362754..2363402,2363459..2363662,2363713..2363819)


exon

Literature and cross-references MpiCIIAC01
DNA ref. JGI genome:   scaffold_3 (2362754..2363819)
Protein sequence: MpiCIIAC01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (297)
PWM (Da):   %s   33456.23 (31380.1)  
PI (pH):   %s   6.66 (6.34) Peptide Signal:   %s   cut: 21 range:23-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTLLKAGIAAAIFTSSIASAAVAGQKRGSSSSCPAIWSQVASQLKRDFNGCNDLARSAIRFAFHDAAGYSSSNPQYAPASGGADGSLLLNDVEVSRSTETPMKQKYRDPYLLPLYQKYKSQGVGAADLVQFAGAVGIKSCPGGPTVKTVVGRIDSSTAAPQGTLPAAFGQGSDYNSLIQLWAAKGISPRELAALMGAHTVSMSFTNERYHIPPGGPQDSDPTVWDNNYFIQTQSQSSQRQAQNSHTQGNNAHSGVYSFDSDVNLSNATTECGQAFTEFANNLNAWNAEFPAAMQKMSLFGIDQGTAAGFVDCTSLIS

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). No EST available.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGACTCTGCTCAAGGCTGGTATCGCTGCAGCAATATTCACATCTTCCATCGCTTCAGCAGCAGTAGCTGGGCAGAAACGCGGTTCCTCCAGCTCTTGCCCAGCGATCTGGTCT
CAAGTCGCCTCGCAGTTGAAGAGAGACTTCAACGGCTGCAACGACCTCGCCCGCTCTGCGATCCGCTTCGCCTTCCACGATGCTGCCGGCTATTCTTCGTCCAATCCACAGTACGCTCCA
GCATCAGGTGGCGCAGATGGATCCCTCCTCCTCAATGACGTCGAAGTCTCCCGTTCGACTGAGACGCCCATGAAGCAGAAGTATCGTGACCCGTACCTGCTCCCACTATATCAGAAGTAC
AAGTCTCAAGGCGTCGGAGCAGCAGATCTGGTGCAATTCGCAGGCGCCGTTGGAATCAAGAGTTGTCCCGGTGGACCAACGGTGAAGACCGTGGTGGGGAGGATTGATTCGAGCACAGCG
GCACCGCAGGGGACATTACCGGCCGCGTTTGGCCAAGGGTCGGATTACAACTCATTGATTCAACTCTGGGCCGCGAAGGGAATCAGTCCGAGGGAGTTGGCAGCGTTGATGGGGGCGCAT
ACTGTGAGCATGTCGTTTACGAATGAGAGATATCACATCCCGCCGGGTG
GTAAGTCTGGAAACAGTCGGCTTTGATCCAACATGTGCTGACTGGTGCGCCACTAGGTCCCCAGGACTCCG
ATCCGACGGTTTGGGATAACAACTACTTTATTCAGACACAGTCGCAAAGCAGCCAGAGGCAGGCGCAGAACAGCCACACGCAGGGGAATAACGCTCATTCGGGCGTATACAGCTTTGATT
CGGATGTGAATCTTTCGAATGCCACGACTGAGTGCGGTCAGGCTTTCACAGAGTTTGCGAATAATTTGA
GTGAGTCGACCTCCGCACTTCGAGATATGCTTGTGCTGACAGGACCGCAGA
TGCTTGGAACGCCGAGTTCCCAGCAGCAATGCAGAAAATGAGTTTGTTTGGCATAGATCAAGGCACAGCGGCCGGCTTTGTCGACTGTACTTCGCTGATATCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGACTCTGCTCAAGGCTGGTATCGCTGCAGCAATATTCACATCTTCCATCGCTTCAGCAGCAGTAGCTGGGCAGAAACGCGGTTCCTCCAGCTCTTGCCCAGCGATCTGGTCT
CAAGTCGCCTCGCAGTTGAAGAGAGACTTCAACGGCTGCAACGACCTCGCCCGCTCTGCGATCCGCTTCGCCTTCCACGATGCTGCCGGCTATTCTTCGTCCAATCCACAGTACGCTCCA
GCATCAGGTGGCGCAGATGGATCCCTCCTCCTCAATGACGTCGAAGTCTCCCGTTCGACTGAGACGCCCATGAAGCAGAAGTATCGTGACCCGTACCTGCTCCCACTATATCAGAAGTAC
AAGTCTCAAGGCGTCGGAGCAGCAGATCTGGTGCAATTCGCAGGCGCCGTTGGAATCAAGAGTTGTCCCGGTGGACCAACGGTGAAGACCGTGGTGGGGAGGATTGATTCGAGCACAGCG
GCACCGCAGGGGACATTACCGGCCGCGTTTGGCCAAGGGTCGGATTACAACTCATTGATTCAACTCTGGGCCGCGAAGGGAATCAGTCCGAGGGAGTTGGCAGCGTTGATGGGGGCGCAT
ACTGTGAGCATGTCGTTTACGAATGAGAGATATCACATCCCGCCGGGTG
GTCCCCAGGACTCCGATCCGACGGTTTGGGATAACAACTACTTTATTCAGACACAGTCGCAAAGCAGCCAG
AGGCAGGCGCAGAACAGCCACACGCAGGGGAATAACGCTCATTCGGGCGTATACAGCTTTGATTCGGATGTGAATCTTTCGAATGCCACGACTGAGTGCGGTCAGGCTTTCACAGAGTTT
GCGAATAATTTGA
ATGCTTGGAACGCCGAGTTCCCAGCAGCAATGCAGAAAATGAGTTTGTTTGGCATAGATCAAGGCACAGCGGCCGGCTTTGTCGACTGTACTTCGCTGATATCGTAG

Retrieve as FASTA