Entry information : ChigCcP
Entry ID 8487
Creation 2011-08-25 (Christophe Dunand)
Last sequence changes 2011-08-25 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-08-25 (Christophe Dunand)
Peroxidase information: ChigCcP
Name ChigCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Colletotrichum
Organism Colletotrichum higginsianum    [TaxId: 80884 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ChigCcP
start..stop
S start..stop
CgraCcP01 730 0 1..361 1..361
CgloCcP01_ST23 694 0 1..361 1..361
CfioCcP01_MH18 684 0 1..361 1..363
CfioCcP01_PJ7 682 0 1..361 1..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..493 493 N° 2 592..965 374 N° 3 1028..1246 219  
join(1..493,592..965,1028..1246)


exon

Literature and cross-references ChigCcP
Protein sequence: ChigCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (238)
PWM (Da):   %s   40323.09 (25283.3)  
PI (pH):   %s   9.04 (5.07) Peptide Signal:   %s   cut: 25 range:25-262
Sequence 403
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSTRQFARAALRSSTRTSFAVAPRQAFRQQGRRFYSSEPAKSGSSTWLWLSGLAVAGAGGAYLYTKEGGVSAGSTPKVVNPTKADYEKVYKVIADRLEENDQYDDGSYGPVLVRLAWHASGTFDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLEPVKQQFPWITYSDLWILGGVAAIQEMQGPIIPYRPGRKDGEAAACTPDGRLPDATKREKHLRDIFYRMGFNDQEIVALSGAHALGRCHTDRSGFDGPWTFSPTVLTNDYYKLLLNEKWQWKKWDGPAQYEDKSTKSLMMLPADYALIQDKTFKKYVEQYAKDNEAFFKDFSNVIVKLFELGVPFSQGAEERWTFKPTWQD*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTCTTCCACGAGACAGTTCGCCCGCGCGGCGCTGAGATCCTCTACTCGCACCTCCTTCGCCGTCGCCCCCCGCCAGGCCTTCCGCCAGCAGGGCCGTCGCTTCTACTCCTCTGAGC
CTGCCAAGTCCGGCAGCTCGACCTGGCTCTGGCTCTCCGGGCTGGCCGTTGCTGGCGCCGGTGGTGCCTACCTCTACACTAAGGAGGGTGGTGTTTCCGCCGGCTCGACTCCCAAGGTCG
TCAACCCCACAAAGGCCGACTACGAGAAGGTGTACAAGGTCATTGCCGATCGCCTTGAGGAGAACGACCAGTATGACGACGGCAGCTACGGCCCCGTCCTTGTCCGTCTCGCATGGCACG
CCAGCGGTACCTTTGACAAGGAGACCGGCACTGGTGGCAGCAACGGCGCCACCATGCGTTTCGCTCCCGAGTCTGACCACGGTGCCAACGCCGGTCTGAAGGCTGCCCGCGACTTCCTTG
AGCCCGTTAAGC
GTAAGCCAACCCCCAATTCCCAGTGCAACTGAGTCTGGCCAGTCTTCTCTTGTTACTTTCTTGCTGTGATGAGGCGCACCTTTCTGACTCCGTAACAGAGCAATTCCC
CTGGATCACCTACTCTGACCTCTGGATCCTCGGCGGCGTCGCCGCCATCCAGGAGATGCAGGGCCCCATTATTCCCTACCGTCCCGGCCGCAAAGACGGCGAGGCTGCCGCCTGCACCCC
TGACGGCCGTCTCCCCGACGCCACGAAGCGCGAGAAGCACCTCCGCGATATCTTCTACCGCATGGGATTCAACGACCAGGAGATCGTCGCCCTGTCCGGCGCCCACGCTCTTGGCCGTTG
CCACACTGACCGCTCCGGTTTCGACGGCCCCTGGACCTTCTCCCCTACCGTCTTGACCAACGACTACTACAAGCTTCTCCTCAACGAGAAGTGGCAGTGGAAGAAGTGGGATGGTCCCGC
TCAG
GTACGTTCCTTAGCCACTTGGCAGGCGTGGCAAACGAGTCGATTGCTAACGGTGTTGCGCAGTACGAGGACAAGAGCACCAAGTCCCTGATGATGCTCCCCGCCGACTACGCCCTG
ATCCAGGACAAGACCTTCAAGAAGTATGTCGAGCAGTACGCCAAGGACAACGAGGCCTTCTTCAAGGACTTCTCCAACGTCATCGTCAAGCTGTTCGAGCTCGGCGTGCCCTTCTCCCAG
GGCGCCGAGGAGCGCTGGACCTTCAAGCCCACTTGGCAGGACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTCTTCCACGAGACAGTTCGCCCGCGCGGCGCTGAGATCCTCTACTCGCACCTCCTTCGCCGTCGCCCCCCGCCAGGCCTTCCGCCAGCAGGGCCGTCGCTTCTACTCCTCTGAGC
CTGCCAAGTCCGGCAGCTCGACCTGGCTCTGGCTCTCCGGGCTGGCCGTTGCTGGCGCCGGTGGTGCCTACCTCTACACTAAGGAGGGTGGTGTTTCCGCCGGCTCGACTCCCAAGGTCG
TCAACCCCACAAAGGCCGACTACGAGAAGGTGTACAAGGTCATTGCCGATCGCCTTGAGGAGAACGACCAGTATGACGACGGCAGCTACGGCCCCGTCCTTGTCCGTCTCGCATGGCACG
CCAGCGGTACCTTTGACAAGGAGACCGGCACTGGTGGCAGCAACGGCGCCACCATGCGTTTCGCTCCCGAGTCTGACCACGGTGCCAACGCCGGTCTGAAGGCTGCCCGCGACTTCCTTG
AGCCCGTTAAGC
AGCAATTCCCCTGGATCACCTACTCTGACCTCTGGATCCTCGGCGGCGTCGCCGCCATCCAGGAGATGCAGGGCCCCATTATTCCCTACCGTCCCGGCCGCAAAGACG
GCGAGGCTGCCGCCTGCACCCCTGACGGCCGTCTCCCCGACGCCACGAAGCGCGAGAAGCACCTCCGCGATATCTTCTACCGCATGGGATTCAACGACCAGGAGATCGTCGCCCTGTCCG
GCGCCCACGCTCTTGGCCGTTGCCACACTGACCGCTCCGGTTTCGACGGCCCCTGGACCTTCTCCCCTACCGTCTTGACCAACGACTACTACAAGCTTCTCCTCAACGAGAAGTGGCAGT
GGAAGAAGTGGGATGGTCCCGCTCAG
TACGAGGACAAGAGCACCAAGTCCCTGATGATGCTCCCCGCCGACTACGCCCTGATCCAGGACAAGACCTTCAAGAAGTATGTCGAGCAGTACG
CCAAGGACAACGAGGCCTTCTTCAAGGACTTCTCCAACGTCATCGTCAAGCTGTTCGAGCTCGGCGTGCCCTTCTCCCAGGGCGCCGAGGAGCGCTGGACCTTCAAGCCCACTTGGCAGG
ACTAA

Retrieve as FASTA