Entry information : WcoCIIBA 
                                
                                | Entry ID | 8494 | 
|---|---|
| Creation | 2011-09-14 (Christophe Dunand) | 
| Last sequence changes | 2011-09-14 (Christophe Dunand) | 
| Sequence status | complete | 
| Reviewer | Christophe Dunand | 
| Last annotation changes | 2015-06-29 (Christophe Dunand) | 
                                    Peroxidase information: WcoCIIBA
                                
                                | Name | WcoCIIBA | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Class | Other class II peroxidase type A [Orthogroup: CIIBA001] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Taxonomy | Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Wolfiporia | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Organism | Wolfiporia cocos [TaxId: 81056 ] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Cellular localisation | N/D | 
                                   ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Tissue type | N/D | 
                                   ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Inducer | N/D | 
                                   ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Repressor | N/D | 
                                   ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Best BLASTp hits | 
                                       
  | 
                                   ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene structure Fichier | 
                        		           Exons►
                        		           
  
                                                 | 
                                    ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
                                Literature and cross-references WcoCIIBA
                            
                               | DNA ref. | JGI genome: scaffold_3 (1758239..1759838) | 
|---|
                                    Protein sequence: WcoCIIBA
                                
                              | Sequence Properties first value : protein second value (mature protein)  | 
                                     
                                        
  | 
                                     ||||||||||||
| Sequence Send to BLAST Send to Peroxiscan  | 
                                       
                                         
  | 
                                   ||||||||||||
| Remarks | Complete sequence from genomic (11 introns). No EST. 5'end looks different without concerved residues. alternative prediction MRQGGVAAQAICQSAGRLHRLASRKLMCDEGLLSCIEPPCCI which need to be confirmed.  | 
                                   ||||||||||||
| DNA ► Send to BLAST  | 
                                     
                                       
  | 
                               ||||||||||||
| CDS► Send to BLAST  | 
                                     
                                         
  | 
                                 ||||||||||||
