Entry information : WcoCIIBA
Entry ID 8494
Creation 2011-09-14 (Christophe Dunand)
Last sequence changes 2011-09-14 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-06-29 (Christophe Dunand)
Peroxidase information: WcoCIIBA
Name WcoCIIBA
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Wolfiporia
Organism Wolfiporia cocos    [TaxId: 81056 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value WcoCIIBA
start..stop
S start..stop
LsulCIIBA01 451 9e-161 22..330 36..344
PplCIIBA 407 1e-143 23..323 8..306
FpinCIIBA 405 1e-142 24..300 42..318
CsuCIIBA 393 1e-137 6..330 19..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1758239..1758281 43 N° 2 1758334..1758362 29 N° 3 1758424..1758441 18 N° 4 1758496..1758521 26
N° 5 1758581..1758685 105 N° 6 1758742..1758755 14 N° 7 1758810..1758851 42 N° 8 1758911..1758989 79
N° 9 1759040..1759334 295 N° 10 1759392..1759536 145 N° 11 1759592..1759758 167 N° 12 1759812..1759838 27
join(1758239..1758281,1758334..1758362,1758424..1758441,1758496..1758521,1758581 ..1758685,1758742..1758755,1758810..1758851,1758911..1758989,1759040..1759334,17 59392..1759536,1759592..1759758,1759812..1759838)


exon

Literature and cross-references WcoCIIBA
DNA ref. JGI genome:   scaffold_3 (1758239..1759838)
Protein sequence: WcoCIIBA
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (313)
PWM (Da):   %s   35365.52 (33558.5)  
PI (pH):   %s   5.81 (5.56) Peptide Signal:   %s   cut: 18 range:18-330
Sequence 371
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRACYLVLSLLAVFVAGMTQKAPECGRWYTILDEIQANLFNEGRCGNQAREAIRLTFHDGIGRSAALQASGRFGGGGADGSIIKFAHTELANPANDGLEDVVYALKHFADNHNVSYGDIIQFAGAVALSNCPGSPRLAFHFGRPQAIAPSPPNLVPSPSDSAEQLLARMEDAGFTADDTVALLAAHSLAVQRTIDPSIPGTPLDSTPGEFDAQFYLEMLLKGTAYPGKGHSSAEAKSPMKHEFRLASDAAVARHSSTACKWQSFIGDQRGLQASFRDAMLKLANQGFDDLVDCSDVIPIPRRSNRLLQYPTGKNYSDIEQFCPDVPFPGL

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns). No EST. 5'end looks different without concerved residues. alternative prediction MRQGGVAAQAICQSAGRLHRLASRKLMCDEGLLSCIEPPCCI which need to be confirmed.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAGGGCTTGTTATCTTGTATTGAGCCTCCTTGCTGTATTCGGTATGTTTCATGAGCGCTATTCATGATGATATAGCTATGCTGAACGCCTCAGTTGCTGGCATGACCCAGAAAGCGCCC
GAG
GCAGGTCATTGACCACCTGTAGCGGATTCAATTGTTCCAGAACCTGCTAACCTTCCTATAGTGTGGCAGGTGGTATACTGTAAGCATATTTCTAACCTATCTGTGATGAATCTGCAA
TCCCATCTGCAATCAGATCCTTGATGAGATACAAGCAAATTTGTAGGTTCATTGGACCGTACATGTGTCTGATGCCCTCATCGCTCCCCGTCGTGCAACAGGTTCAACGAAGGACGTTGT
GGAAACCAAGCTCGAGAAGCCATCCGCTTGACATTCCATGATGGGATCGGTCGCTCGGCGGCGTTGCAGGCTTCAGGAAGATTTGG
GTGAGTATGCTAGTGTCGGTTGAATCTTGGTGGC
TGATGAGCAATTCATTGAAAAGAGGAGGGGGCGCAGGTAAAGCTTCAATAGTTGCCTAATTATAATACAATAAATCATCGTGCTGTTCAGATGGCAGCATCATCAAATTTGCCCACACGG
AGTTGGCCAACC
GTTAGGTCCCTTCTCTGCACGGTTGCACTCTGATTGTAATTATGCTGATTACCCGATAGCGGCAAATGACGGCCTGGAGGATGTAGTATACGCTCTCAAGCACTTTGC
CGATAACCACAACGTCAGCTACGGTGACAT
GTGCGTCCCACTGGCGTGTCTATAATGCGTAGATGCTGATGTTGTCGCAGAATTCAATTCGCCGGAGCAGTCGCCCTCTCAAATTGTCCT
GGAAGTCCTCGTCTTGCATTCCATTTCGGGCGTCCTCAGGCAATCGCCCCATCTCCTCCGAACCTTGTTCCCTCTCCTTCGGACTCCGCTGAGCAGCTCCTCGCACGCATGGAAGACGCA
GGCTTCACGGCGGACGATACTGTCGCGCTTCTGGCCGCTCATTCACTTGCGGTGCAAAGAACAATCGATCCAAGCATCCCTGGCACCCCCCTCGATTCTACTCCGGGAGAGTTTGACGCG
CAGTTCTATTTGGAG
GTGTGATGCACAGCCAGAGTGACCACTGGTTTACCTTTAGCTGAGTTGCGTCTGCAGATGCTGCTGAAAGGCACCGCCTATCCTGGGAAAGGGCATAGCTCAGCG
GAGGCGAAGTCCCCAATGAAGCACGAGTTCCGGCTTGCCTCGGATGCTGCAGTGGCCCGTCATAGCAGTACTGCGTGCAAGTGGCAGTCCTTCATTG
GTAAGTCCGAAGTGCTCCCGGCA
AGAAGAACATACTCATGACTTTATCTGAGCAGGCGATCAAAGAGGCCTGCAAGCATCATTCCGTGACGCTATGCTGAAGCTCGCTAATCAGGGCTTCGACGACCTCGTCGATTGCTCAGA
TGTCATCCCCATCCCAAGGCGCTCAAACCGTCTCTTACAGTATCCGACAGGCAAGAACTACTCCGATATTGAACAGTTT
GTAAGTTGGCAGCAAAAGGATGTCATGCAAAGTCGTACTTA
CGAGATGAACAGTGTCCTGATGTCCCCTTTCCTGGGCTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAGGGCTTGTTATCTTGTATTGAGCCTCCTTGCTGTATTCGTTGCTGGCATGACCCAGAAAGCGCCCGAGTGTGGCAGGTGGTATACTATCCTTGATGAGATACAAGCAAATTTGTTCA
ACGAAGGACGTTGTGGAAACCAAGCTCGAGAAGCCATCCGCTTGACATTCCATGATGGGATCGGTCGCTCGGCGGCGTTGCAGGCTTCAGGAAGATTTGG
AGGAGGGGGCGCAGATGGCA
GCATCATCAAATTTGCCCACACGGAGTTGGCCAACC
CGGCAAATGACGGCCTGGAGGATGTAGTATACGCTCTCAAGCACTTTGCCGATAACCACAACGTCAGCTACGGTGACATAATTC
AATTCGCCGGAGCAGTCGCCCTCTCAAATTGTCCTGGAAGTCCTCGTCTTGCATTCCATTTCGGGCGTCCTCAGGCAATCGCCCCATCTCCTCCGAACCTTGTTCCCTCTCCTTCGGACT
CCGCTGAGCAGCTCCTCGCACGCATGGAAGACGCAGGCTTCACGGCGGACGATACTGTCGCGCTTCTGGCCGCTCATTCACTTGCGGTGCAAAGAACAATCGATCCAAGCATCCCTGGCA
CCCCCCTCGATTCTACTCCGGGAGAGTTTGACGCGCAGTTCTATTTGGAG
ATGCTGCTGAAAGGCACCGCCTATCCTGGGAAAGGGCATAGCTCAGCGGAGGCGAAGTCCCCAATGAAGC
ACGAGTTCCGGCTTGCCTCGGATGCTGCAGTGGCCCGTCATAGCAGTACTGCGTGCAAGTGGCAGTCCTTCATTG
GCGATCAAAGAGGCCTGCAAGCATCATTCCGTGACGCTATGCTGA
AGCTCGCTAATCAGGGCTTCGACGACCTCGTCGATTGCTCAGATGTCATCCCCATCCCAAGGCGCTCAAACCGTCTCTTACAGTATCCGACAGGCAAGAACTACTCCGATATTGAACAGT
TT
TGTCCTGATGTCCCCTTTCCTGGGCTA

Retrieve as FASTA