Entry information : ShirCIIBA01
Entry ID 8504
Creation 2011-09-20 (Christophe Dunand)
Last sequence changes 2011-09-20 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-30 (Nizar Fawal)
Peroxidase information: ShirCIIBA01
Name ShirCIIBA01
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Stereaceae Stereum
Organism Stereum hirsutum    [TaxId: 40492 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ShirCIIBA01
start..stop
S start..stop
HanCIIBB04 328 2.14e-111 14..361 6..353
PstrCIIBB02 327 3.77e-111 32..361 23..355
PoVP04_PC15 326 1.66e-110 7..363 9..355
PoVP04_PC9 323 1.21e-109 7..349 9..341
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8504' 'join(220637..220712,220807..221146,221209..221330,221389..221464,221517..221630,221687..221766,221852..222063,222128..222211)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 220637..220712 74 N° 2 220807..221146 338 N° 3 221209..221330 120 N° 4 221389..221464 74
N° 5 221517..221630 112 N° 6 221687..221766 78 N° 7 221852..222063 210 N° 8 222128..222211 82
join(220637..220712,220807..221146,221209..221330,221389..221464,221517..221630, 221687..221766,221852..222063,222128..222211)


exon

Literature and cross-references ShirCIIBA01
DNA ref. JGI genome:   scaffold_14 (220637..222211)
Cluster/Prediction ref. JGI gene:   6856
Protein sequence: ShirCIIBA01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367 (341)
PWM (Da):   %s   39075.25 (36361.6)  
PI (pH):   %s   4.6 (4.45) Peptide Signal:   %s   cut: 27 range:27-367
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSLLVLLLRVGGVLLLSAQLQVARGISIGSSRREACPDGIHSTNNAVCCPL
/span>FALRDTLQTSVFENTCGANSRLALRLTFHDALGYSTTRNMGGGSDGSIIQYAEIETAYPANAGLNGIIGQYLDFYKNNQVPLSYGD
FIQFAGAVAMTNCPGSPTLQFFMGRPDAKGPALNGAISNADSSDVILARFADAGFNSDEVVTLLASHSVAKQSSLSSAPLDSTPALFDTQYYAET
MLKGTVWP
GAPNITGEVMSPTRSQVRLASDVFIADPRTACKWQGYVNDQQRMQSDFQAAMLKMSLLGQDQSALTDCSDVIENAPPLPQPATYFPDNFTVADVNQCSSTPFPNLPSAPGER
DGFSPRLGRRD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTCATTGTTGGTCCTGCTTCTTCGCGTCGGCGGTGTCTTACTTCTATCGGCCCAGCTGCAGGTCGCCCGCGCGGTGCGTCTAGTTCTCTCCGACTGTCTGTCCAAACTTCCCTAG
TTTCAACAACCACTCATTAGTTGGGAATGACAACTTCTGTACCATGGTACAGGTATTTCGATCGGCTCAAGCCGTAGAGAAGCCTGTCCAGACGGAATTCACTCGACCAACAACGCCGTC
TGCTGTCCTCTCTTTGCCCTCCGGGACACACTTCAGACCAGCGTGTTCGAAAATACATGTGGCGCCAACTCCCGCCTAGCACTTCGTCTCACGTTTCACGATGCACTGGGGTATTCAACG
ACGCGTAACATGGGAGGCGGATCCGATGGTTCTATCATTCAATACGCGGAGATCGAGACAGCATACCCGGCGAATGCGGGGTTGAATGGCATTATTGGACAGTACTTGGACTTTTACAAG
AATAATCAGGTCCCGCTCAGCTATGGAGATTT
TTGTGAGTGGGTGTCTTAGCGATGTGCAGTCTCTATCTGTTCTCATACGACTTGTGCGAACTAGTATTCAGTTCGCGGGTGCCGTAGC
TATGACCAACTGTCCAGGATCTCCAACGTTACAATTCTTCATGGGTCGCCCCGACGCTAAAGGACCTGCATTGAATGGAGCAATATCTAATGCACCTG
TGGTTATCATTCCGCACCCAGT
CCCTTCGTCCGAATTACTCATGGACTACTTGGTTACAGACTCCTCGGATGTGATACTTGCCCGCTTCGCAGATGCAGGCTTCAACAGCGACGAAGTCGTGACTCTGTTGGCGTCTCGTAA
GTTTTTTCACTTGTTTTGCTGTGGCCGTTGACGAACCGATACTCTCAGACACTCTGTTGCCAAACAGTCTTCCCTTTCTAGTGCTCCTCTCGATAGCACGCCTGCTCTTTTCGACACGCA
ATACTATGCTGAGACCATGCTGAAGGGTACGGTATGGCCTGG
GGGTACGTTGCAATTTATCATGCAGTCTTCGTGGCGCCCCTGAATGACCCTGACCTAGCGCTCCGAATATTACTGGCG
AAGTCATGTCTCCGACCCGCTCACAAGTACGACTGGCCTCTGACGTGTTCATCGCACAGG
GGGTACCTGTCACTCTAACCGCCTATGTTCTTCTTCATGCACATATCCTCATCTGTGGCA
ACACACCTACTTACGCACCTTTCACAGATCCTCGTACCGCTTGCAAGTGGCAAGGCTACGTCAACGATCAGCAAAGGATGCAGTCCGATTTCCAAGCTGCCATGCTCAAAATGTCGCTTC
TGGGTCAGGATCAAAGCGCTCTCACTGACTGCTCAGACGTCATCGAGAATGCACCGCCGCTCCCTCAACCGGCGACATATTTTCCGGACAATTTCACGGTGGCGGATGTCAACCAAACA
C
AGTACGTCTGTTCGCATTTGGTTCGGCCATCACAACTCCGAGCTGATCTATATTCATGGTCACAGTGTTCTAGCACGCCCTTCCCAAATCTTCCATCCGCCCCAGGTGAGCGAGACGGTT
TCTCTCCAAGACTTGGACGACGAGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTCATTGTTGGTCCTGCTTCTTCGCGTCGGCGGTGTCTTACTTCTATCGGCCCAGCTGCAGGTCGCCCGCGGTATTTCGATCGGCTCAAGCCGTAGAGAAGCCTGTCCAGACGGA
ATTCACTCGACCAACAACGCCGTCTGCTGTCCTCTCTTTGCCCTCCGGGACACACTTCAGACCAGCGTGTTCGAAAATACATGTGGCGCCAACTCCCGCCTAGCACTTCGTCTCACGTTT
CACGATGCACTGGGGTATTCAACGACGCGTAACATGGGAGGCGGATCCGATGGTTCTATCATTCAATACGCGGAGATCGAGACAGCATACCCGGCGAATGCGGGGTTGAATGGCATTATT
GGACAGTACTTGGACTTTTACAAGAATAATCAGGTCCCGCTCAGCTATGGAGATTT
TATTCAGTTCGCGGGTGCCGTAGCTATGACCAACTGTCCAGGATCTCCAACGTTACAATTCTTC
ATGGGTCGCCCCGACGCTAAAGGACCTGCATTGAATGGAGCAATATCTAATGCACCTG
ACTCCTCGGATGTGATACTTGCCCGCTTCGCAGATGCAGGCTTCAACAGCGACGAAGTCGTG
ACTCTGTTGGCGTC
ACACTCTGTTGCCAAACAGTCTTCCCTTTCTAGTGCTCCTCTCGATAGCACGCCTGCTCTTTTCGACACGCAATACTATGCTGAGACCATGCTGAAGGGTACGGTA
TGGCCTGG
CGCTCCGAATATTACTGGCGAAGTCATGTCTCCGACCCGCTCACAAGTACGACTGGCCTCTGACGTGTTCATCGCACAGGATCCTCGTACCGCTTGCAAGTGGCAAGGCTAC
GTCAACGATCAGCAAAGGATGCAGTCCGATTTCCAAGCTGCCATGCTCAAAATGTCGCTTCTGGGTCAGGATCAAAGCGCTCTCACTGACTGCTCAGACGTCATCGAGAATGCACCGCCG
CTCCCTCAACCGGCGACATATTTTCCGGACAATTTCACGGTGGCGGATGTCAACCAAACA
TGTTCTAGCACGCCCTTCCCAAATCTTCCATCCGCCCCAGGTGAGCGAGACGGTTTCTCT
CCAAGACTTGGACGACGAGACTGA

Retrieve as FASTA