Entry information : DsVP01(VP1)
Entry ID 8507
Creation 2011-09-21 (Christophe Dunand)
Last sequence changes 2011-09-21 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: DsVP01(VP1)
Name DsVP01(VP1)
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsVP01
start..stop
S start..stop
DsVP02 646 0 1..364 1..365
DsVP03 635 0 1..364 1..364
GapCIIBA01 569 0 1..364 1..364
GauCIIBA01 566 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 168954..169070 117 N° 2 169124..169167 44 N° 3 169219..169264 46 N° 4 169320..169378 59
N° 5 169430..169443 14 N° 6 169497..169617 121 N° 7 169675..169906 232 N° 8 169971..170140 170
N° 9 170202..170239 38 N° 10 170299..170511 213 N° 11 170568..170592 25 N° 12 170652..170667 16
join(168954..169070,169124..169167,169219..169264,169320..169378,169430..169443, 169497..169617,169675..169906,169971..170140,170202..170239,170299..170511,17056 8..170592,170652..170667)


exon

Literature and cross-references DsVP01(VP1)
DNA ref. JGI genome:   scaffold_49 (168954..170667)
Cluster/Prediction ref. JGI gene:   9407
Protein sequence: DsVP01(VP1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (346)
PWM (Da):   %s   37938.54 (36158.5)  
PI (pH):   %s   4.02 (3.98) Peptide Signal:   %s   cut: 19 range:19-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSRVVISLAVLVASVAAAVPSVSKRATCSGGRTTANAACCVWFDVLDDIQENLFHGGQCGEDAHEALLTFHDAIAFSPALTAAGQFGGGGDGSIMAHTSDELADPANNGLDDIIEFQRPFALKHNVSFGDFIQFAGAVGVSNCNGGPQISFFAGRSNDSQAAPHGLVPLPSDDVTTILNRVGDAGFNAVELVWLLISHTVGAQDSVDSIPGTPFDSTPSDFDAQFFVETLLNGTLTPGNGISPDEALSPYPGEFRLQSDFLIARDDRTSCEWQKMSDRANMLARFEQVMLKLSLLGFDQSTLTDCSDVIPTATGTVADPFIPAGLSTDDIQAACSSTPFPTVSVLGGAVTTIPAVSLNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCTAGAGTTGTCATCTCGCTCGCTGTCCTCGTTGCGTCTGTCGCTGCCGCCGTCCCGTCGGTGAGCAAGCGTGCGACGTGCAGCGGTGGCCGGACCACCGCTAACGCCGCGGTA
TGTGGCTCCATCGTTGCTATGACTGAGCGCAACACTAACAGTAGGAGCAGTGCTGCGTCTGGTTCGATGTCCTAGATGACATCCAGGAGAATCTGTGAGTCGCTCAATACTCGTTGCATC
GCCTTGAATTCACGCTCCTGAACAGGTTCCACGGCGGACAGTGTGGCGAGGATGCCCACGAAGCCCTAAGGGTAAAAACACTATGTCCTCCGGGGAACAAGGCACTAACTGAGCAACGAT
CGACAGCTGACCTTCCATGACGCGATTGCATTCTCCCCTGCTCTTACGGCTGCGGGTCAGTTTGGGTGAGCTTCAGTATCAATCTCTTCCTGTGCTGAGTACTGATGGTTTTGTAGTGGC
GGAGGTGCTG
GTAAGCACTACATCTTGGCTTGCCTTCGGTTGTCATGCTAGATGTGTTTGCAGACGGCTCCATCATGGCGCATACTTCCGATGAGTTAGCTGATCCTGCAAACAACGGTC
TCGACGACATCATCGAATTTCAGCGCCCGTTTGCCCTCAAACACAATGTCTCCTTCGGCGACTT
GTACGCTCTCCTGAACGTATTCAGATCAACGCCGATAAACTGATGTTGTTCTCTTA
GCATCCAATTCGCCGGCGCTGTCGGTGTCTCTAACTGCAACGGAGGGCCCCAGATCTCATTCTTTGCTGGCCGTTCCAACGACTCGCAGGCTGCTCCCCACGGTCTCGTTCCTCTCCCGT
CTGACGATGTCACCACCATTCTGAACCGGGTGGGTGATGCTGGCTTCAACGCCGTTGAGCTCGTTTGGCTCCTCATCTCTCACACGGTCGGCGCCCAGGATAGTGTGGACGAC
GTAAGTA
GTTACGGCACAATATGTGAGAGGATGGGTGTCCTGATGCCCCCCCTTTGTGCTGTAGTCGATTCCTGGCACTCCGTTCGACTCAACCCCCTCGGATTTCGATGCTCAATTCTTCGTTGAG
ACCTTATTGAACGGTACGCTCACGCCCGGCAACGGCATTAGCCCCGACGAGGCACTCTCGCCCTACCCCGGAGAGTTCCGCCTGCAGTCTGACTTCCTGATCGCTCG
GTGAGTGGAACTG
TCATTAGCCGTAGCAGCGCCGGAAATGAGCTGAACTCTCGACTTACAGGGATGATCGTACCTCTTGCGAGTGGCAGAAGATGATCTGTGCGTGGCCTAAGCATCAGCATCGTGATCTGAA
TCTGTAATAACGTTGTGTTCTGCAGCGGACCGTGCGAACATGCTGGCGCGCTTTGAGCAGGTCATGCTGAAGCTCTCACTGCTCGGTTTCGACCAGTCCACACTCACCGATTGTTCCGAT
GTCATCCCCACTGCAACCGGAACTGTGGCCGATCCGTTCATCCCCGCAGGTCTCTCGACGGATGACATCCAAGCTGCATGCTCTTCGACTCCATTCCCCACGGTGTCTGTGCTTGGAG
GT
GAGTCGATCGCGCAACCATTCCATTCATCCCATCTGATGAGCTTGTAACCGTAGGCGCTGTCACTACGATCCCCGCTGTGTGAGTCCATCCAACGTGCGCGTCTCTGGATGAGTGGACTA
AGGTTTTACCTTCCCTAGGTCCTTGAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGTCTAGAGTTGTCATCTCGCTCGCTGTCCTCGTTGCGTCTGTCGCTGCCGCCGTCCCGTCGGTGAGCAAGCGTGCGACGTGCAGCGGTGGCCGGACCACCGCTAACGCCGCGTGC
TGCGTCTGGTTCGATGTCCTAGATGACATCCAGGAGAATCT
GTTCCACGGCGGACAGTGTGGCGAGGATGCCCACGAAGCCCTAAGGCTGACCTTCCATGACGCGATTGCATTCTCCCCT
GCTCTTACGGCTGCGGGTCAGTTTGG
TGGCGGAGGTGCTGACGGCTCCATCATGGCGCATACTTCCGATGAGTTAGCTGATCCTGCAAACAACGGTCTCGACGACATCATCGAATTTCAG
CGCCCGTTTGCCCTCAAACACAATGTCTCCTTCGGCGACTT
CATCCAATTCGCCGGCGCTGTCGGTGTCTCTAACTGCAACGGAGGGCCCCAGATCTCATTCTTTGCTGGCCGTTCCAAC
GACTCGCAGGCTGCTCCCCACGGTCTCGTTCCTCTCCCGTCTGACGATGTCACCACCATTCTGAACCGGGTGGGTGATGCTGGCTTCAACGCCGTTGAGCTCGTTTGGCTCCTCATCTCT
CACACGGTCGGCGCCCAGGATAGTGTGGACGAC
TCGATTCCTGGCACTCCGTTCGACTCAACCCCCTCGGATTTCGATGCTCAATTCTTCGTTGAGACCTTATTGAACGGTACGCTCACG
CCCGGCAACGGCATTAGCCCCGACGAGGCACTCTCGCCCTACCCCGGAGAGTTCCGCCTGCAGTCTGACTTCCTGATCGCTCG
GGATGATCGTACCTCTTGCGAGTGGCAGAAGATGATC
T
CGGACCGTGCGAACATGCTGGCGCGCTTTGAGCAGGTCATGCTGAAGCTCTCACTGCTCGGTTTCGACCAGTCCACACTCACCGATTGTTCCGATGTCATCCCCACTGCAACCGGAACT
GTGGCCGATCCGTTCATCCCCGCAGGTCTCTCGACGGATGACATCCAAGCTGCATGCTCTTCGACTCCATTCCCCACGGTGTCTGTGCTTGGAG
GCGCTGTCACTACGATCCCCGCTGTG
TCCTTGAACTCTTGA

Retrieve as FASTA