Entry information : DsVP03(VP3)
Entry ID 8508
Creation 2011-09-21 (Christophe Dunand)
Last sequence changes 2016-06-24 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: DsVP03(VP3)
Name DsVP03(VP3)
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsVP03
start..stop
S start..stop
DsVP01 635 0 1..364 1..364
DsVP02 622 0 25..364 26..365
GapCIIBA01 575 0 1..364 1..364
GauCIIBA01 573 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 135906..136022 117 N° 2 135809..135852 44 N° 3 135711..135756 46 N° 4 135599..135657 59
N° 5 135534..135547 14 N° 6 135360..135480 121 N° 7 135069..135300 232 N° 8 134836..135005 170
N° 9 134736..134773 38 N° 10 134465..134677 213 N° 11 134385..134409 25 N° 12 134314..134329 16
complement(join(134314..134329,134385..134409,134465..134677,134736..134773,1348 36..135005,135069..135300,135360..135480,135534..135547,135599..135657,135711..1 35756,135809..135852,135906..136022))


exon

Literature and cross-references DsVP03(VP3)
DNA ref. JGI genome:   scaffold_20 (136022..134314)
Cluster/Prediction ref. JGI gene:   4836
Protein sequence: DsVP03(VP3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (346)
PWM (Da):   %s   38058.61 (36151.6)  
PI (pH):   %s   4.13 (4.08) Peptide Signal:   %s   cut: 19 range:19-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFSKIFISLAVLAASVAAVVPSVSKRTTCSGGQTTANAACCVWFDVLDDIQENLFHGGQCGEDAHESLRLTFHDAIAFSPALTAAGQFGGGGADGSIMAHTSEELADPANNGLDDIIEFQRPFALKHNVSFGDFIQFAGAVGVSNCNGGPQISFFAGRSNDSQPAPHGLVPLPSDDVTTILNRVGDAGFSTVELVWLLISHTVGAQDKVDDSIPGTPFDSTPSDFDAQFFVETLLNGTITPGNGISPGEALSPYPGEFRLQSDFLIARDNRTSCEWQKMISNRANMLARFEGVMQKLSLLGFNQSALTDCSDVIPTATGTVADPFIPAGLSTDDIQAACSSTPFPTVSVLGGAVTTIPAVPLNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (11 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTCCAAAATCTTCATCTCGCTCGCCGTCCTTGCTGCGTCTGTCGCCGCCGTCGTTCCGTCTGTGAGCAAGCGTACGACGTGCAGTGGTGGCCAGACCACCGCGAACGCCGCAGTA
TGTGGCTCCTTCGCCGCTTCGACCGAGCGTACCGCTAACAGTCGGAGCAGTGCTGTGTCTGGTTTGATGTCCTCGATGACATCCAGGAGAATCTGTAAGTCGCTGACCGCCCGTTGCATC
GCCTATAGCCTTATGCCCCGTGACAGCTTCCACGGCGGACAGTGTGGCGAAGACGCACACGAATCTCTTAGGGTGAAAGCACTATCCGTTCCTTTAGAAACGACTCACTAATAAATGGAC
TGCAGCTGACATTCCACGACGCAATCGCGTTCTCCCCCGCTCTTACTGCCGCGGGCCAGTTTGGGTAAGATTCAGCATCATTCTCCTTCCGTGTCAGGTGCTGATCAATCTGCAGTGGCG
GAGGTGCTG
GTACGCACTTCATATTGACATGCCTATAGTCTCCATGCTACATGTAACTGCAGACGGCTCGATTATGGCGCATACCTCCGAAGAGTTGGCTGACCCTGCAAACAACGGTCT
CGACGACATCATCGAGTTTCAACGTCCTTTTGCCCTCAAGCACAATGTCTCCTTCGGCGACTT
GTAAGCTTTCCTGAAAACATCTGACGCGGCTCCGATAGACTGAAATCACTTTTTGAT
AGTATCCAATTCGCCGGCGCTGTCGGTGTCTCGAACTGCAACGGCGGGCCCCAGATCTCATTCTTCGCCGGCCGTTCCAATGACTCGCAGCCTGCTCCCCACGGCCTCGTACCCCTCCCG
TCTGACGATGTCACCACCATCTTGAACCGGGTCGGCGATGCTGGCTTCAGCACTGTGGAGCTCGTTTGGCTCCTCATCTCCCACACGGTCGGCGCCCAAGACAAGGTGGACGAC
GTGAGT
AGTCATTGCATAACTTGTCGGAGATTGGGTGTCCTGATGACCGCTTTGTGCTGGTAGTCAATTCCTGGTACTCCGTTCGACTCAACTCCCTCGGATTTCGACGCTCAGTTCTTTGTTGAG
ACCCTGTTGAACGGCACAATCACGCCTGGCAACGGCATCAGTCCTGGCGAGGCACTGTCGCCCTACCCCGGAGAGTTCCGCCTTCAGTCTGACTTCCTGATTGCTCG
GTGAGCGGAACCG
TCATCAGATGTTTGCGGCATTGGAATTGAACTTAATGCCTGACTTGCAGGGATAACCGCACCTCTTGCGAGTGGCAGAAGATGATCTGTGCGTGTTCTATGTCATAGCGTCGTGATCTGT
ACTGAAGCTTTTTTTTTTTTTGCAGCGAACCGTGCGAACATGCTGGCACGCTTCGAAGGGGTCATGCAGAAGCTCTCACTGCTCGGATTCAACCAGTCCGCGCTCACCGATTGTTCCGAT
GTCATCCCAACCGCAACCGGCACTGTGGCCGATCCGTTCATCCCGGCCGGTCTCTCGACCGATGACATCCAAGCTGCTTGCTCTTCGACTCCTTTCCCCACGGTGTCGGTGCTTGGAG
GT
GAGTCGAGCGCATACTAACCGCATCCATTGCAACTAACGTTACGCGACTCTAGGCGCTGTCACCACGATTCCCGCTGTGTGAGTATCTGTAATGTGCGCATCCTTGAATGAGTTCACTGA
TCTCCTTCGGTAGGCCTTTGAACTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTCCAAAATCTTCATCTCGCTCGCCGTCCTTGCTGCGTCTGTCGCCGCCGTCGTTCCGTCTGTGAGCAAGCGTACGACGTGCAGTGGTGGCCAGACCACCGCGAACGCCGCATGC
TGTGTCTGGTTTGATGTCCTCGATGACATCCAGGAGAATCT
CTTCCACGGCGGACAGTGTGGCGAAGACGCACACGAATCTCTTAGGCTGACATTCCACGACGCAATCGCGTTCTCCCCC
GCTCTTACTGCCGCGGGCCAGTTTGG
TGGCGGAGGTGCTGACGGCTCGATTATGGCGCATACCTCCGAAGAGTTGGCTGACCCTGCAAACAACGGTCTCGACGACATCATCGAGTTTCAA
CGTCCTTTTGCCCTCAAGCACAATGTCTCCTTCGGCGACTT
TATCCAATTCGCCGGCGCTGTCGGTGTCTCGAACTGCAACGGCGGGCCCCAGATCTCATTCTTCGCCGGCCGTTCCAAT
GACTCGCAGCCTGCTCCCCACGGCCTCGTACCCCTCCCGTCTGACGATGTCACCACCATCTTGAACCGGGTCGGCGATGCTGGCTTCAGCACTGTGGAGCTCGTTTGGCTCCTCATCTCC
CACACGGTCGGCGCCCAAGACAAGGTGGACGAC
TCAATTCCTGGTACTCCGTTCGACTCAACTCCCTCGGATTTCGACGCTCAGTTCTTTGTTGAGACCCTGTTGAACGGCACAATCACG
CCTGGCAACGGCATCAGTCCTGGCGAGGCACTGTCGCCCTACCCCGGAGAGTTCCGCCTTCAGTCTGACTTCCTGATTGCTCG
GGATAACCGCACCTCTTGCGAGTGGCAGAAGATGATC
T
CGAACCGTGCGAACATGCTGGCACGCTTCGAAGGGGTCATGCAGAAGCTCTCACTGCTCGGATTCAACCAGTCCGCGCTCACCGATTGTTCCGATGTCATCCCAACCGCAACCGGCACT
GTGGCCGATCCGTTCATCCCGGCCGGTCTCTCGACCGATGACATCCAAGCTGCTTGCTCTTCGACTCCTTTCCCCACGGTGTCGGTGCTTGGAG
GCGCTGTCACCACGATTCCCGCTGTG
CCTTTGAACTCTTAA

Retrieve as FASTA