Entry information : DsVP02(VP2)
Entry ID 8509
Creation 2011-09-21 (Christophe Dunand)
Last sequence changes 2016-06-24 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2019-05-10 (Catherine )
Peroxidase information: DsVP02(VP2)
Name DsVP02(VP2)
Class Versatile peroxidase    [Orthogroup: VP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Polyporaceae Dichomitus
Organism Dichomitus squalens    [TaxId: 114155 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DsVP02
start..stop
S start..stop
DsVP01 647 0 1..365 1..364
DsVP03 622 0 26..365 25..364
GapCIIBA01 550 0 1..365 1..364
GauCIIBA01 546 0 1..365 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46102..46221 120 N° 2 46007..46050 44 N° 3 45910..45955 46 N° 4 45800..45858 59
N° 5 45734..45747 14 N° 6 45561..45681 121 N° 7 45270..45501 232 N° 8 45037..45206 170
N° 9 44937..44974 38 N° 10 44665..44877 213 N° 11 44585..44609 25 N° 12 44511..44526 16
complement(join(44511..44526,44585..44609,44665..44877,44937..44974,45037..45206 ,45270..45501,45561..45681,45734..45747,45800..45858,45910..45955,46007..46050,4 6102..46221))


exon

Literature and cross-references DsVP02(VP2)
DNA ref. JGI genome:   scaffold_20 (46221..44511)
Cluster/Prediction ref. JGI gene:   5855
Protein sequence: DsVP02(VP2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366 (345)
PWM (Da):   %s   38095.63 (35982.4) Transmb domain:   %s   i2-24o
PI (pH):   %s   4.03 (3.99) Peptide Signal:   %s   cut: 21 range:21-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLFRVVISLAVLSVSVAVAAAPAVSKRATCNGGRTTANAACCIWFDVLDDIQENLFHGGQCGEDAHEALRLTFHDAIVFSPALTAAGQFGGGGADGSIMAHSSDELADPANNGLDDIIEFQCPFALKHNVSFGDFIQFAGAVGVSNCNGGPQISFFTGRSNDSQAAPHGLVPLPSDDVTTILNRVGNAGFNAVELVWLLISHTVGAQDSVDDSIPGTPLDSTPSDFDAQFFVETLLNGTITPGNGISPGEALSPYPGEFRLQSDFLIARDDRTSCEWQKMISDRANMLARFEQVMLKLSLLGFDQSTLTDCSDVIPTATGTVADPFIPAGLSTDDIQAACSSTPFPTVSVLGGAVTTIPAVSLNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (10 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTTCAGAGTTGTCATCTCGCTCGCTGTCCTCTCTGTGTCGGTCGCCGTCGCCGCCGCCCCGGCGGTGAGCAAGCGTGCGACGTGCAACGGTGGCCGGACCACCGCTAACGCCGCG
GTATGTGGCTTTTTGCCGCTATGCGGAGCGTACCACTGATGGTCGGAGCAGTGCTGCATATGGTTCGATGTTCTCGATGACATCCAAGAGAATCTGTGAGTTTCTCGATACTCGGTGCAT
CGCCTTGTAATGACGCTCCTGAACAGGTTCCATGGCGGACAGTGTGGCGAGGATGCCCACGAAGCCCTAAGGGTGAGGACACTCCGTCCACTAGGGGACAAAACACTAAACAATGATCGG
CAGCTGACTTTCCATGACGCAATCGTGTTCTCCCCTGCTCTTACAGCTGCAGGTCAATTCGGGTGAGCTTTAGCGGCAATCTCTTTTGGTCGCTGAGTACTGACGGTTTCGTAGTGGCGG
AGGTGCCG
GTAAGCACTGCATCTTTACCTGTCGTAATTGTCATTCTAGATGTGTCTGTAGACGGCTCAATCATGGCGCATAGCTCTGATGAGTTGGCTGACCCTGCGAACAACGGTCTCG
ACGACATCATCGAGTTTCAGTGTCCGTTTGCCCTTAAGCACAATGTCTCCTTCGGCGACTT
GTACGCTCTCCTGGGCGCATTCACACTAATGCCGATGCACTGATATTGTTTGTTGATAG

CATTCAATTCGCCGGCGCTGTCGGTGTCTCGAACTGCAATGGAGGGCCACAGATCTCCTTCTTTACCGGTCGTTCCAACGACTCGCAGGCTGCTCCCCACGGTCTCGTCCCTCTCCCGTC
TGACGATGTCACCACCATTCTGAACCGGGTCGGCAATGCTGGCTTCAACGCCGTTGAGCTCGTTTGGCTCCTCATCTCTCACACGGTCGGCGCTCAGGATAGTGTGGACGAC
GTGAGTAG
TTACGGCACAATATGTGAAAGGATGGGTGTCCTGATGCACTCTTTTGTGCTGTAGTCGATTCCTGGCACTCCGCTCGACTCAACCCCCTCGGATTTCGACGCTCAGTTCTTCGTTGAGAC
CTTATTGAACGGTACAATCACGCCCGGCAACGGTATTAGTCCCGGCGAGGCACTGTCGCCCTATCCCGGAGAGTTCCGCCTGCAGTCTGACTTCCTGATTGCTCG
GTGAGTGGAACTGTC
ATTAGCCGTAGCAGCGCCGGGATTGAGTTGAACTCATCGACTTACAGGGATGACCGTACCTCTTGCGAGTGGCAGAAGATGATCTGTGCGTGGCCTAAGCAATAGCATCGGGATCTGAAT
CTGTAACAACGTTGCGTTCTGCAGCAGACCGTGCGAACATGCTGGCGCGCTTTGAACAGGTCATGCTGAAGCTCTCACTGCTCGGTTTCGACCAGTCCACACTCACCGATTGTTCCGATG
TCATCCCCACTGCAACTGGCACTGTGGCCGATCCGTTCATCCCCGCCGGTCTCTCTACGGATGACATCCAAGCTGCATGCTCTTCGACTCCTTTCCCCACGGTGTCTGTGCTCGGAG
GTG
AGTCGATCGCGCAATCATTACATTCATCTCATCTGATGATCTGTAACTGTAGGCGCTGTTACTACGATCCCCGCTGTGTGAGTCCATCCAACGTGCGCGTCTCTGGATGACTGGACTGAG
TTATACCTTCCCTAGGTCGTTGAACTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTTCAGAGTTGTCATCTCGCTCGCTGTCCTCTCTGTGTCGGTCGCCGTCGCCGCCGCCCCGGCGGTGAGCAAGCGTGCGACGTGCAACGGTGGCCGGACCACCGCTAACGCCGCG
TGCTGCATATGGTTCGATGTTCTCGATGACATCCAAGAGAATCTGTTCCATGGCGGACAGTGTGGCGAGGATGCCCACGAAGCCCTAAGGCTGACTTTCCATGACGCAATCGTGTTCTCC
CCTGCTCTTACAGCTGCAGGTCAATTCGG
TGGCGGAGGTGCCGACGGCTCAATCATGGCGCATAGCTCTGATGAGTTGGCTGACCCTGCGAACAACGGTCTCGACGACATCATCGAGTTT
CAGTGTCCGTTTGCCCTTAAGCACAATGTCTCCTTCGGCGACTT
CATTCAATTCGCCGGCGCTGTCGGTGTCTCGAACTGCAATGGAGGGCCACAGATCTCCTTCTTTACCGGTCGTTCC
AACGACTCGCAGGCTGCTCCCCACGGTCTCGTCCCTCTCCCGTCTGACGATGTCACCACCATTCTGAACCGGGTCGGCAATGCTGGCTTCAACGCCGTTGAGCTCGTTTGGCTCCTCATC
TCTCACACGGTCGGCGCTCAGGATAGTGTGGACGAC
TCGATTCCTGGCACTCCGCTCGACTCAACCCCCTCGGATTTCGACGCTCAGTTCTTCGTTGAGACCTTATTGAACGGTACAATC
ACGCCCGGCAACGGTATTAGTCCCGGCGAGGCACTGTCGCCCTATCCCGGAGAGTTCCGCCTGCAGTCTGACTTCCTGATTGCTCG
GGATGACCGTACCTCTTGCGAGTGGCAGAAGATG
ATCT
CAGACCGTGCGAACATGCTGGCGCGCTTTGAACAGGTCATGCTGAAGCTCTCACTGCTCGGTTTCGACCAGTCCACACTCACCGATTGTTCCGATGTCATCCCCACTGCAACTGGC
ACTGTGGCCGATCCGTTCATCCCCGCCGGTCTCTCTACGGATGACATCCAAGCTGCATGCTCTTCGACTCCTTTCCCCACGGTGTCTGTGCTCGGAG
GCGCTGTTACTACGATCCCCGCT
GT
GTCGTTGAACTCTTAA

Retrieve as FASTA