Entry information : PstrMnP10 (MnP10)
Entry ID 8520
Creation 2011-09-22 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-30 (Nizar Fawal)
Peroxidase information: PstrMnP10 (MnP10)
Name (synonym) PstrMnP10 (MnP10)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrMnP10
start..stop
S start..stop
PbreMnP01 615 0 1..381 1..381
PbreMnP03 613 0 1..384 1..384
PsoMnP02 610 0 1..380 1..377
PstrMnP06 610 0 1..380 1..378
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2567910..2568038 129 N° 2 2568093..2568211 119 N° 3 2568267..2569176 910  
join(2567910..2568038,2568093..2568211,2568267..2569176)


exon

Literature and cross-references PstrMnP10 (MnP10)
DNA ref. JGI genome:   scaffold_2 (2567910..2569176)
Protein sequence: PstrMnP10 (MnP10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   385 (367)
PWM (Da):   %s   40767.15 (38922.2)  
PI (pH):   %s   4.63 (4.63) Peptide Signal:   %s   cut: 19 range:19-385
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSFFAFVILAAVASAAPANQAGVCPDGTHVSNKACCAFIPLAQDLQQTVFQNECGEDAHEVIRLTFHDAIAISQRQGPKAGGGADGSMLLFPRVEPEFHANDGIDDSVNNLIPFLAKHPVSAGDLVQFAGAVALSNCPGAPRLEFLAGRPNHTIPAVDGLIPEPQDSVDKILARFEDAGNFSPFEVVSLLSSHSVARADKVDTTIDAAPFDSTPFTFDTQIFLEVLLKGVDFPGTNNNTGEVSSPLSKHSGNDTGELRLQSDFLLARDPRTACFWQGFVNEQDFMSSSFRAAMAKLAVLGHNRNDLIDCSEVVPVPKPAVKKPATFPATKTRNDLDKLTCNKPFPALGTDPGPTETLIPHCPDGGQFCPSVQFDGPATGSSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCACATCTTTCTTTGCTTTCGTCATACTCGCCGCGGTCGCCTCCGCTGCTCCTGCCAACCAAGCTGGCGTATGCCCCGACGGCACCCACGTATCGAACAAGGCGTGTTGCGCT
TTCATTCCT
GTAAGCAGACATACTTCAGTACTGTTTGCGCATGAATAATTATTCCCCTCATAGCTCGCGCAAGATCTTCAGCAAACCGTCTTCCAGAATGAGTGTGGCGAAGATGCTCAC
GAGGTCATCCGCTTGACTTTCCACGATGCGATTGCCATTTCCCAGAGGCAAGGTCCTAAGGC
GTGAGTTATCGTCTTTATATCCGCTTTTGTCCTGCTCACCGGGCTCATCTCGTAGTGG
TGGAGGCGCGGACGGTTCAATGTTGCTTTTCCCTCGCGTTGAGCCTGAGTTCCACGCCAACGACGGTATTGACGACTCCGTCAACAACCTTATCCCTTTCCTCGCCAAGCACCCGGTCAG
CGCTGGTGACCTCGTTCAATTCGCCGGCGCGGTCGCGCTCAGCAACTGCCCCGGTGCCCCGCGCCTCGAGTTCTTGGCCGGTCGACCGAACCACACCATTCCTGCGGTTGATGGCCTCAT
TCCCGAACCACAGGACAGCGTCGACAAAATACTCGCACGCTTTGAGGACGCCGGCAATTTCTCGCCATTCGAGGTCGTCTCACTCCTCTCTTCGCATTCCGTCGCCCGCGCGGACAAGGT
GGACACCACGATCGACGCAGCTCCGTTTGATTCCACGCCCTTCACCTTCGACACCCAGATCTTCCTCGAGGTGCTCTTGAAGGGCGTAGACTTCCCCGGGACAAACAATAACACGGGCGA
AGTCTCCTCCCCTCTCTCCAAGCACTCGGGCAACGATACAGGGGAGCTGCGCCTTCAGTCCGACTTCTTGCTTGCGCGTGACCCGCGCACTGCCTGCTTCTGGCAAGGCTTCGTGAACGA
GCAAGACTTCATGAGCAGCTCTTTCAGAGCGGCCATGGCTAAGCTCGCCGTCCTCGGTCACAACCGCAACGACCTCATCGACTGCTCCGAGGTCGTTCCCGTCCCCAAGCCCGCCGTAAA
GAAGCCCGCGACGTTCCCTGCCACGAAGACCAGGAATGATCTCGACAAGTTGACCTGTAACAAGCCCTTCCCTGCCTTAGGCACCGACCCTGGCCCCACTGAGACGCTCATCCCTCATTG
CCCGGACGGTGGCCAGTTCTGCCCCTCCGTGCAGTTCGACGGTCCGGCCACGGGCTCGTCATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCACATCTTTCTTTGCTTTCGTCATACTCGCCGCGGTCGCCTCCGCTGCTCCTGCCAACCAAGCTGGCGTATGCCCCGACGGCACCCACGTATCGAACAAGGCGTGTTGCGCT
TTCATTCCT
CTCGCGCAAGATCTTCAGCAAACCGTCTTCCAGAATGAGTGTGGCGAAGATGCTCACGAGGTCATCCGCTTGACTTTCCACGATGCGATTGCCATTTCCCAGAGGCAAGGT
CCTAAGGC
TGGTGGAGGCGCGGACGGTTCAATGTTGCTTTTCCCTCGCGTTGAGCCTGAGTTCCACGCCAACGACGGTATTGACGACTCCGTCAACAACCTTATCCCTTTCCTCGCCAAG
CACCCGGTCAGCGCTGGTGACCTCGTTCAATTCGCCGGCGCGGTCGCGCTCAGCAACTGCCCCGGTGCCCCGCGCCTCGAGTTCTTGGCCGGTCGACCGAACCACACCATTCCTGCGGTT
GATGGCCTCATTCCCGAACCACAGGACAGCGTCGACAAAATACTCGCACGCTTTGAGGACGCCGGCAATTTCTCGCCATTCGAGGTCGTCTCACTCCTCTCTTCGCATTCCGTCGCCCGC
GCGGACAAGGTGGACACCACGATCGACGCAGCTCCGTTTGATTCCACGCCCTTCACCTTCGACACCCAGATCTTCCTCGAGGTGCTCTTGAAGGGCGTAGACTTCCCCGGGACAAACAAT
AACACGGGCGAAGTCTCCTCCCCTCTCTCCAAGCACTCGGGCAACGATACAGGGGAGCTGCGCCTTCAGTCCGACTTCTTGCTTGCGCGTGACCCGCGCACTGCCTGCTTCTGGCAAGGC
TTCGTGAACGAGCAAGACTTCATGAGCAGCTCTTTCAGAGCGGCCATGGCTAAGCTCGCCGTCCTCGGTCACAACCGCAACGACCTCATCGACTGCTCCGAGGTCGTTCCCGTCCCCAAG
CCCGCCGTAAAGAAGCCCGCGACGTTCCCTGCCACGAAGACCAGGAATGATCTCGACAAGTTGACCTGTAACAAGCCCTTCCCTGCCTTAGGCACCGACCCTGGCCCCACTGAGACGCTC
ATCCCTCATTGCCCGGACGGTGGCCAGTTCTGCCCCTCCGTGCAGTTCGACGGTCCGGCCACGGGCTCGTCATCTTGA

Retrieve as FASTA