Entry information : PstrMnP08 (MnP8)
Entry ID 8522
Creation 2011-09-22 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-29 (Nizar Fawal)
Peroxidase information: PstrMnP08 (MnP8)
Name (synonym) PstrMnP08 (MnP8)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrMnP08
start..stop
S start..stop
PstrMnP06 675 0 1..381 1..378
PstrMnP07 666 0 1..381 1..378
PsoMnP02 638 0 1..381 1..377
PcMnP02_OGC101 638 0 1..381 1..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1984592..1984772 181 N° 2 1984470..1984536 67 N° 3 1984015..1984414 400 N° 4 1983549..1983963 415
N° 5 1983413..1983495 83  
complement(join(1983413..1983495,1983549..1983963,1984015..1984414,1984470..1984 536,1984592..1984772))


exon

Literature and cross-references PstrMnP08 (MnP8)
DNA ref. JGI genome:   scaffold_2 (1984772..1983413)
Protein sequence: PstrMnP08 (MnP8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   381 (363)
PWM (Da):   %s   39785.43 (37965.4)  
PI (pH):   %s   4.2 (4.15) Peptide Signal:   %s   cut: 19 range:19-381
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFASLVTFVALAAVTRAAPTSEAAVCSDGTRVSNSACCAFIPLAQDLQQTIFQNECGEDAHEVIRLTFHDAIAISQSQGPRAGGGADGSMLLFPTVEPNFAANNGIDDSVNNLIPFLARHPTISAGDLVQFAGAVALTNCPGAPQLEFMAGRPNHTIAAVDGLIPEPQDSVDKILARFQDAGNFSPFEVVSLLASHSVARADKVDETIDAAPFDTPFVMDTQIFLEVLLKGTGFPGSPNNTGEVASPLPLTSGTDTGEMRLQSDFALARDSRTACFWQSFVNQQEFMAASFKSAMAKLAVLGHNRNSLIDCSDVVPAASTVAVAPASFPATQGPADLEITCTARAFPTLTQDRGATETLIPHCPDGSENCTSVQFDGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCGTCCCTCGTCACCTTCGTCGCTCTCGCCGCTGTCACCCGCGCCGCGCCCACCAGCGAGGCTGCCGTCTGCTCTGACGGCACTCGCGTGTCCAACAGCGCGTGCTGCGCG
TTCATTCCGCTCGCGCAGGATCTTCAACAGACCATCTTCCAGAACGAGTGCGGCGAAGATG
GTATGCTTTCTTTGCCTTCCCCGTGGAGCAATTCACCGACGCCGACCCTGCGCAGCTCA
CGAGGTCATCCGGTTAACCTTCCACGACGCCATTGCTATCAGCCAGAGCCAAGGTCCCAGAGC
GTAAGCTGTTTTTTAAGCTGCCGGAGTTAATCTGTCCAACTGACACTCTCCGCAGAG
GTGGCGGCGCTGACGGCTCCATGCTCCTGTTCCCGACCGTCGAGCCCAACTTCGCTGCAAACAACGGCATCGACGACTCTGTAAACAACCTGATCCCATTCCTCGCCAGGCACCCTACGA
TCAGCGCCGGCGATCTCGTTCAGTTCGCAGGCGCGGTCGCCCTCACCAACTGCCCTGGCGCACCCCAGCTCGAGTTCATGGCCGGCCGCCCCAACCACACGATCGCCGCCGTCGACGGCC
TCATCCCCGAGCCGCAGGACAGCGTCGACAAGATTCTAGCCCGGTTTCAGGACGCAGGCAACTTCTCGCCCTTCGAGGTTGTTTCGCTCCTCGCCTCGCACAGCGTCGCTCGCGCTGACA
AGGTCGACGAAACCATCGACGCCGCGCCCTTCGACTCC
GTAAGCACCATTCAGAATCCTTGCCGGGATATCCGCTGACGTCTTTTTCAGACGCCTTTCGTTATGGACACCCAGATCTTCC
TTGAGGTCCTCCTCAAGGGCACCGGCTTCCCTGGCTCTCCCAACAACACAGGCGAGGTCGCGTCGCCCCTCCCGCTGACCTCTGGCACCGACACCGGCGAGATGCGCCTGCAGTCCGACT
TCGCGCTCGCCCGCGATTCGCGCACGGCCTGCTTCTGGCAAAGCTTTGTCAACCAGCAAGAGTTCATGGCAGCCAGCTTCAAATCCGCCATGGCCAAACTTGCCGTCCTCGGCCACAACC
GCAACTCGCTCATCGACTGCTCCGATGTCGTCCCCGCCGCCAGCACGGTCGCGGTTGCCCCCGCGTCGTTCCCCGCCACCCAAGGCCCGGCCGACCTCGAGATCACCTGCACCGCACGCG
CTTTCCCGACGCTCACCCAAGACC
GTACGTGCTCACCCCCTTTCCGCCACTTTTTTCTCGAATCTGACTCGAACCAGGTGGTGCGACTGAGACCCTCATCCCTCACTGCCCCGATGGCAG
CGAAAACTGCACGTCTGTCCAGTTCGACGGCCCCGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCGTCCCTCGTCACCTTCGTCGCTCTCGCCGCTGTCACCCGCGCCGCGCCCACCAGCGAGGCTGCCGTCTGCTCTGACGGCACTCGCGTGTCCAACAGCGCGTGCTGCGCG
TTCATTCCGCTCGCGCAGGATCTTCAACAGACCATCTTCCAGAACGAGTGCGGCGAAGATG
CTCACGAGGTCATCCGGTTAACCTTCCACGACGCCATTGCTATCAGCCAGAGCCAAGGT
CCCAGAGC
AGGTGGCGGCGCTGACGGCTCCATGCTCCTGTTCCCGACCGTCGAGCCCAACTTCGCTGCAAACAACGGCATCGACGACTCTGTAAACAACCTGATCCCATTCCTCGCCAGG
CACCCTACGATCAGCGCCGGCGATCTCGTTCAGTTCGCAGGCGCGGTCGCCCTCACCAACTGCCCTGGCGCACCCCAGCTCGAGTTCATGGCCGGCCGCCCCAACCACACGATCGCCGCC
GTCGACGGCCTCATCCCCGAGCCGCAGGACAGCGTCGACAAGATTCTAGCCCGGTTTCAGGACGCAGGCAACTTCTCGCCCTTCGAGGTTGTTTCGCTCCTCGCCTCGCACAGCGTCGCT
CGCGCTGACAAGGTCGACGAAACCATCGACGCCGCGCCCTTCGACTCC
ACGCCTTTCGTTATGGACACCCAGATCTTCCTTGAGGTCCTCCTCAAGGGCACCGGCTTCCCTGGCTCTCCC
AACAACACAGGCGAGGTCGCGTCGCCCCTCCCGCTGACCTCTGGCACCGACACCGGCGAGATGCGCCTGCAGTCCGACTTCGCGCTCGCCCGCGATTCGCGCACGGCCTGCTTCTGGCAA
AGCTTTGTCAACCAGCAAGAGTTCATGGCAGCCAGCTTCAAATCCGCCATGGCCAAACTTGCCGTCCTCGGCCACAACCGCAACTCGCTCATCGACTGCTCCGATGTCGTCCCCGCCGCC
AGCACGGTCGCGGTTGCCCCCGCGTCGTTCCCCGCCACCCAAGGCCCGGCCGACCTCGAGATCACCTGCACCGCACGCGCTTTCCCGACGCTCACCCAAGACC
GTGGTGCGACTGAGACC
CTCATCCCTCACTGCCCCGATGGCAGCGAAAACTGCACGTCTGTCCAGTTCGACGGCCCCGCTTAA

Retrieve as FASTA