Entry information : PstrMnP07 (MnP7)
Entry ID 8523
Creation 2011-09-22 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-29 (Nizar Fawal)
Peroxidase information: PstrMnP07 (MnP7)
Name (synonym) PstrMnP07 (MnP7)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrMnP07
start..stop
S start..stop
PstrMnP06 735 0 1..378 1..378
PstrMnP08 687 0 1..378 1..381
PsoMnP02 661 0 1..378 1..377
PcMnP02_OGC101 649 0 1..378 1..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 487919..488090 172 N° 2 488146..488612 467 N° 3 488672..489086 415 N° 4 489154..489236 83
join(487919..488090,488146..488612,488672..489086,489154..489236)


exon

Literature and cross-references PstrMnP07 (MnP7)
DNA ref. JGI genome:   scaffold_12 (487919..489236)
Protein sequence: PstrMnP07 (MnP7)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378 (360)
PWM (Da):   %s   39199.5 (37409.5)  
PI (pH):   %s   4.37 (4.32) Peptide Signal:   %s   cut: 19 range:19-378
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFASLLAFVALAAVARSAPTAVCPDGTRVSNAACCAFIPLAKDLQETIFQNECGEDAHEVIRLTFHDAIAISQSLGPKAGGGADGSMLLFPTVEPNFAANNGIDDSVNNLIPFLARHPTISAGDLVQFAGTVALSNCPGAPQLEFLAGRPNKTIAAVDGLIPEPQDSVSKILARFEDAGNFSPFEVVSLLASHSVARADKVDLTIDAAPFDTPFTFDTQVFLEVLLKGTGFPGTGNNTGEVTSPLPVGSGNDTGELRLQSDFALARDSRTACFWQGFVNQQEFMAASFKAAMAKLAVLGHNRNSLIDCSDVVPAPSTAAVKPASFPATKGPADLEIACTARAFPTLTSDRGATETLIPHCPDGGQDCPAVQFDGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCGTCCCTCCTCGCCTTTGTCGCTCTCGCCGCCGTTGCGCGCTCTGCACCGACCGCCGTCTGCCCCGACGGCACCCGGGTCAGCAACGCGGCCTGCTGCGCGTTCATCCCC
CTCGCCAAGGATCTCCAGGAGACCATCTTCCAAAACGAATGCGGTGAAGATG
GTAAGCGCGTTCCTGCTCTTAACTCTTAACAAGGAACTGACCTCGTCCTTACTAGCCCACGAGGTCAT
CCGTCTGACCTTCCACGACGCCATTGCCATCTCCCAGAGCCTCGGTCCCAAGGCTGGCGGAGGCGCCGACGGATCCATGCTCCTCTTCCCCACCGTCGAGCCCAACTTCGCCGCCAACAA
CGGTATCGACGACAGCGTCAACAACCTCATCCCGTTCCTCGCTCGTCACCCGACGATCAGTGCCGGTGATCTCGTCCAGTTCGCTGGCACCGTTGCGTTGAGCAACTGCCCCGGCGCGCC
CCAACTGGAGTTCTTGGCTGGCCGCCCCAACAAGACGATCGCGGCCGTCGACGGCCTGATCCCGGAGCCGCAAGATAGCGTGTCGAAGATCCTGGCGCGGTTCGAGGATGCGGGCAACTT
CTCGCCCTTCGAGGTCGTCTCTCTCCTCGCTTCTCACTCGGTCGCGCGTGCGGACAAGGTTGACTTGACCATCGACGCCGCTCCGTTCGACTCG
GTGAGCATCCTTTCAGCTTAACCTGC
TGAGACAACGAAGCTGACTATCTGCACCCTTAGACGCCGTTCACCTTCGATACCCAGGTGTTCCTCGAGGTGCTCCTCAAGGGTACCGGGTTCCCCGGCACGGGCAACAACACCGGCGAG
GTCACCTCTCCTCTCCCCGTCGGCAGCGGCAACGACACCGGCGAGCTCCGCCTGCAATCCGACTTTGCGCTCGCCCGGGACTCGCGCACGGCGTGCTTCTGGCAAGGATTCGTTAACCAG
CAGGAGTTCATGGCGGCGAGCTTCAAGGCGGCGATGGCCAAGCTCGCGGTGCTCGGGCACAACCGGAACTCGCTCATCGACTGCTCGGATGTCGTCCCCGCGCCGAGCACCGCCGCGGTA
AAGCCGGCGTCGTTCCCGGCGACGAAGGGCCCGGCCGACCTCGAGATCGCCTGCACCGCGCGCGCGTTCCCGACTCTCACCAGCGACC
GTGAGTGTGCTCGCGTGTTCCGCCCGCGGGAA
ATTTTCTTGCTCACGCCGCTGTGTCTTCTCTTCAGGCGGGGCTACTGAGACCCTCATCCCTCACTGCCCCGACGGCGGCCAGGACTGCCCTGCCGTCCAGTTCGACGGCCCGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCGTCCCTCCTCGCCTTTGTCGCTCTCGCCGCCGTTGCGCGCTCTGCACCGACCGCCGTCTGCCCCGACGGCACCCGGGTCAGCAACGCGGCCTGCTGCGCGTTCATCCCC
CTCGCCAAGGATCTCCAGGAGACCATCTTCCAAAACGAATGCGGTGAAGATG
CCCACGAGGTCATCCGTCTGACCTTCCACGACGCCATTGCCATCTCCCAGAGCCTCGGTCCCAAGGCT
GGCGGAGGCGCCGACGGATCCATGCTCCTCTTCCCCACCGTCGAGCCCAACTTCGCCGCCAACAACGGTATCGACGACAGCGTCAACAACCTCATCCCGTTCCTCGCTCGTCACCCGACG
ATCAGTGCCGGTGATCTCGTCCAGTTCGCTGGCACCGTTGCGTTGAGCAACTGCCCCGGCGCGCCCCAACTGGAGTTCTTGGCTGGCCGCCCCAACAAGACGATCGCGGCCGTCGACGGC
CTGATCCCGGAGCCGCAAGATAGCGTGTCGAAGATCCTGGCGCGGTTCGAGGATGCGGGCAACTTCTCGCCCTTCGAGGTCGTCTCTCTCCTCGCTTCTCACTCGGTCGCGCGTGCGGAC
AAGGTTGACTTGACCATCGACGCCGCTCCGTTCGACTCG
ACGCCGTTCACCTTCGATACCCAGGTGTTCCTCGAGGTGCTCCTCAAGGGTACCGGGTTCCCCGGCACGGGCAACAACACC
GGCGAGGTCACCTCTCCTCTCCCCGTCGGCAGCGGCAACGACACCGGCGAGCTCCGCCTGCAATCCGACTTTGCGCTCGCCCGGGACTCGCGCACGGCGTGCTTCTGGCAAGGATTCGTT
AACCAGCAGGAGTTCATGGCGGCGAGCTTCAAGGCGGCGATGGCCAAGCTCGCGGTGCTCGGGCACAACCGGAACTCGCTCATCGACTGCTCGGATGTCGTCCCCGCGCCGAGCACCGCC
GCGGTAAAGCCGGCGTCGTTCCCGGCGACGAAGGGCCCGGCCGACCTCGAGATCGCCTGCACCGCGCGCGCGTTCCCGACTCTCACCAGCGACC
GCGGGGCTACTGAGACCCTCATCCCT
CACTGCCCCGACGGCGGCCAGGACTGCCCTGCCGTCCAGTTCGACGGCCCGGCTTAA

Retrieve as FASTA