Entry information : PstrMnP06 (MnP6 / MNP4)
Entry ID 8524
Creation 2011-09-22 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-29 (Nizar Fawal)
Peroxidase information: PstrMnP06 (MnP6 / MNP4)
Name (synonym) PstrMnP06 (MnP6 / MNP4)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Punctularia
Organism Punctularia strigosozonata    [TaxId: 202698 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PstrMnP06
start..stop
S start..stop
PstrMnP07 711 0 1..378 1..378
PstrMnP08 675 0 1..378 1..381
PsoMnP02 649 0 1..378 1..377
PcMnP02_OGC101 639 0 1..378 1..382
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 474087..474258 172 N° 2 474314..474780 467 N° 3 474840..475254 415 N° 4 475309..475391 83
join(474087..474258,474314..474780,474840..475254,475309..475391)


exon

Literature and cross-references PstrMnP06 (MnP6 / MNP4)
DNA ref. JGI genome:   scaffold_12 (474087..475391)
Protein sequence: PstrMnP06 (MnP6 / MNP4)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378 (360)
PWM (Da):   %s   39452.69 (37632.7)  
PI (pH):   %s   4.47 (4.42) Peptide Signal:   %s   cut: 19 range:19-378
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFASLLTFVALAAVARSVPTSVCPDGTRVSNRACCAFIPLAQDLQETIFQNECGEDAHEVIRLTFHDAIAISQSLGPKAGGGADGSMLLFPTVEPNFAANNGIDDSVNNLIPFLARHPTISAGDLVQFAGTVALSNCPGAPQLEFLAGRPNKTIAAVDGLIPEPQDSVSKILARFEDAGNFSPFEVVSLLASHSVARADKVDLTIDAAPFDTPFTFDTQVFLEVLLKGTGFPGTGNNTGEVTSPLPVGSGNDTGELRLQSDFALARDSRTACFWQGFVNQQEFMAASFKAAMAKLAVLGHSRNSLIDCSDVVPATIKATVKPAAFPATKAPADLEIACHARAFPTLTSDRGATETLIPHCPDGGQDCPAVQFDGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCGTCCCTCCTGACTTTCGTCGCTCTCGCCGCCGTTGCGCGCTCTGTACCCACCTCCGTCTGCCCCGATGGCACTCGCGTTAGCAACAGGGCCTGCTGCGCGTTCATCCCC
CTCGCCCAGGATCTTCAGGAGACCATCTTCCAAAACGAATGCGGTGAAGATG
GTAAGCGCGTTCCTGCTCTTAACTCTTACCAAGGAATTAACCTCGTCCTTACTAGCCCACGAGGTCAT
CCGTCTGACCTTCCATGACGCCATTGCCATCTCCCAGAGCCTCGGTCCCAAGGCTGGCGGAGGCGCCGACGGCTCCATGCTCCTCTTCCCCACCGTCGAGCCCAACTTCGCCGCCAACAA
CGGTATCGACGACAGCGTCAACAACCTCATCCCGTTCCTCGCTCGTCACCCGACGATCAGCGCCGGTGACCTCGTCCAGTTCGCTGGCACCGTTGCGTTGAGCAACTGCCCCGGCGCGCC
CCAACTGGAGTTCTTGGCTGGCCGTCCCAACAAGACGATCGCGGCCGTCGACGGCCTGATCCCGGAGCCGCAAGACAGCGTGTCGAAGATCCTGGCGCGGTTCGAGGATGCGGGCAACTT
CTCGCCCTTCGAGGTCGTCTCTCTCCTCGCTTCTCACTCGGTCGCGCGTGCGGACAAGGTTGACTTGACCATCGACGCCGCTCCGTTCGACTCG
GTGAGCATCCCTGCAGCGTAACCTGC
TGAGACAACGAAGCTGACTATCTGCACCCTCAGACGCCGTTCACCTTCGATACCCAGGTGTTCCTCGAGGTGCTCCTCAAGGGTACCGGTTTTCCCGGCACGGGCAACAACACGGGCGAG
GTCACCTCTCCTCTCCCCGTCGGCAGCGGCAACGACACCGGCGAGCTCCGCCTGCAATCCGACTTTGCGCTCGCGCGCGACTCGCGCACGGCGTGCTTCTGGCAAGGATTCGTTAACCAG
CAAGAGTTCATGGCGGCGAGCTTCAAGGCGGCGATGGCCAAGCTCGCGGTGCTCGGGCACAGCCGGAACTCGCTCATCGACTGCTCGGACGTCGTCCCCGCCACGATTAAGGCAACTGTG
AAGCCCGCGGCGTTCCCGGCGACGAAGGCCCCGGCCGACCTCGAGATCGCTTGCCACGCCAGGGCGTTCCCTACTCTTACCAGCGACC
GTATGTGCACTCGTCCTCCGGATTGATCCCCC
CTGCTGACACTCGTCTTCTTAGGCGGCGCCACTGAGACCCTCATCCCTCACTGCCCTGACGGCGGCCAGGATTGCCCTGCTGTTCAATTCGACGGCCCAGCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCGCGTCCCTCCTGACTTTCGTCGCTCTCGCCGCCGTTGCGCGCTCTGTACCCACCTCCGTCTGCCCCGATGGCACTCGCGTTAGCAACAGGGCCTGCTGCGCGTTCATCCCC
CTCGCCCAGGATCTTCAGGAGACCATCTTCCAAAACGAATGCGGTGAAGATG
CCCACGAGGTCATCCGTCTGACCTTCCATGACGCCATTGCCATCTCCCAGAGCCTCGGTCCCAAGGCT
GGCGGAGGCGCCGACGGCTCCATGCTCCTCTTCCCCACCGTCGAGCCCAACTTCGCCGCCAACAACGGTATCGACGACAGCGTCAACAACCTCATCCCGTTCCTCGCTCGTCACCCGACG
ATCAGCGCCGGTGACCTCGTCCAGTTCGCTGGCACCGTTGCGTTGAGCAACTGCCCCGGCGCGCCCCAACTGGAGTTCTTGGCTGGCCGTCCCAACAAGACGATCGCGGCCGTCGACGGC
CTGATCCCGGAGCCGCAAGACAGCGTGTCGAAGATCCTGGCGCGGTTCGAGGATGCGGGCAACTTCTCGCCCTTCGAGGTCGTCTCTCTCCTCGCTTCTCACTCGGTCGCGCGTGCGGAC
AAGGTTGACTTGACCATCGACGCCGCTCCGTTCGACTCG
ACGCCGTTCACCTTCGATACCCAGGTGTTCCTCGAGGTGCTCCTCAAGGGTACCGGTTTTCCCGGCACGGGCAACAACACG
GGCGAGGTCACCTCTCCTCTCCCCGTCGGCAGCGGCAACGACACCGGCGAGCTCCGCCTGCAATCCGACTTTGCGCTCGCGCGCGACTCGCGCACGGCGTGCTTCTGGCAAGGATTCGTT
AACCAGCAAGAGTTCATGGCGGCGAGCTTCAAGGCGGCGATGGCCAAGCTCGCGGTGCTCGGGCACAGCCGGAACTCGCTCATCGACTGCTCGGACGTCGTCCCCGCCACGATTAAGGCA
ACTGTGAAGCCCGCGGCGTTCCCGGCGACGAAGGCCCCGGCCGACCTCGAGATCGCTTGCCACGCCAGGGCGTTCCCTACTCTTACCAGCGACC
GCGGCGCCACTGAGACCCTCATCCCT
CACTGCCCTGACGGCGGCCAGGATTGCCCTGCTGTTCAATTCGACGGCCCAGCCTAA

Retrieve as FASTA