Entry information : PcMnP05
Entry ID 8526
Creation 2011-09-22 (Christophe Dunand)
Last sequence changes 2011-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-30 (Nizar Fawal)
Peroxidase information: PcMnP05
Name PcMnP05
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcMnP05
start..stop
S start..stop
PcMnP02_OGC101 711 0 1..381 1..382
PcMnP02_RP78 709 0 1..381 1..382
PsoMnP02 688 0 1..381 1..377
PsoMnP01 665 0 1..381 1..381
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1395073..1395201 129 N° 2 1395256..1395307 52 N° 3 1395359..1395385 27 N° 4 1395438..1395655 218
N° 5 1395715..1395936 222 N° 6 1395989..1396403 415 N° 7 1396460..1396542 83  
join(1395073..1395201,1395256..1395307,1395359..1395385,1395438..1395655,1395715 ..1395936,1395989..1396403,1396460..1396542)


exon

Literature and cross-references PcMnP05
DNA ref. JGI genome:   scaffold_7 (1395073..1396542)
Protein sequence: PcMnP05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   381 (363)
PWM (Da):   %s   39889.57 (38098.6)  
PI (pH):   %s   4.16 (4.16) Peptide Signal:   %s   cut: 19 range:19-381
Sequence 422
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSTLLAFVALAAVTLAAPTTDTAVCPDGTRVSNAACCAFVPLAQDLQETLFMGDCGEDAHEVIRLTFHDAIAISQSQGPEAGGGADGSMLLFPTIEPNFEANNGIDDSVNNLIPFMQKHNTISAADLVQFAGAVALSNCPGAPRLEFLAGRPNTTIPAVEGLIPEPQDSVTKILQRFEDAGNFSPFEVVSLLASHSIARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGTGFPGTANNTGEVASPLPLGSGTDTGEMRLQSDFALARDSRTACIWQSFVNQQEFMAASFKAAMSKLAILGHSRSNLIDCSDVVPVPKPAVNKPATFPATKGPQDLELTCTSEKFPTLTTDPGATETLIPHCSNGGMSCPAVQFDGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTCTCCACTCTCCTCGCCTTCGTTGCTCTCGCGGCTGTGACGCTCGCTGCCCCAACCACAGACACCGCTGTCTGTCCCGACGGCACACGCGTCAGTAACGCAGCTTGTTGCGCAT
TTGTTCCA
GTAAGCCCTTCCTTACTACTCACCTAGACGTCCGTCTCTGATTACACACTTCAGCTGGCTCAAGACCTCCAGGAGACCCTCTTCATGGGCGACTGCGGTGAAGATGGTTGGT
GATCGTATTATTTTGTCCTCATACCGACCTGACGTTCGCCCCCAGCGCATGAGGTCATTCGTCTCACCTTCCGTGCGTCACTTTCTTCTGGGCTTGCGGCTAGCGCGGTTGACGGATCAT
GCAGACGACGCCATTGCTATCTCTCAGAGCCAGGGACCCGAGGCCGGCGGTGGTGCTGACGGCTCCATGCTGCTCTTCCCGACTATCGAGCCGAATTTTGAGGCGAACAACGGCATTGAC
GACTCCGTGAACAACCTTATCCCCTTCATGCAGAAGCACAACACGATCAGCGCCGCTGACCTCGTCCAGTTCGCGGGAGCCGTTGCTCTCAGTAACTGCCCC
GTAAGTTGTGCCATTGCG
CGTCCTGAGGCCGCCCAGTGTCTCACGTGTTGTCGTTGCAGGGCGCCCCTCGCCTCGAGTTCCTCGCTGGTCGCCCGAACACGACTATTCCCGCCGTCGAGGGCCTCATCCCTGAGCCGC
AGGACAGTGTCACCAAAATTCTACAACGCTTCGAGGACGCAGGGAACTTCTCGCCTTTTGAGGTCGTATCCCTCCTCGCCTCTCACAGTATTGCTCGTGCGGACAAGGTTGACGAGACCA
TCGACGCCGCACCCTTCGATTCC
GTGAGTATCTGCTGTACACCTTTTAATACCGCAGCTAACCATGCCGTACCAGACGCCTTTCACTTTCGACACCCAGGTCTTCCTCGAGGTCCTTCTG
AAGGGAACAGGCTTCCCCGGAACGGCCAACAACACCGGTGAGGTCGCGTCCCCACTTCCCCTCGGCAGCGGCACGGACACCGGCGAGATGCGACTCCAGTCAGACTTTGCGCTCGCCCGC
GACTCGCGCACTGCGTGCATCTGGCAGAGCTTCGTCAACCAGCAGGAGTTCATGGCCGCGAGCTTTAAGGCTGCGATGAGCAAACTCGCGATACTCGGCCACAGTCGTAGCAACCTGATC
GACTGCAGCGACGTCGTGCCGGTGCCGAAGCCTGCGGTTAACAAGCCTGCGACGTTCCCCGCCACCAAGGGCCCGCAGGATCTCGAGCTCACGTGTACCAGCGAGAAGTTCCCGACGCTC
ACTACCGACC
GTAAGCTTCCTTCTGCTAGTGTGCCTCTAATTATGCTTACGACGCTTTCTCTATAGCGGGCGCCACGGAAACCCTTATTCCCCACTGCTCGAACGGCGGCATGTCCTGCC
CTGCTGTTCAGTTCGACGGCCCGGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCTTCTCCACTCTCCTCGCCTTCGTTGCTCTCGCGGCTGTGACGCTCGCTGCCCCAACCACAGACACCGCTGTCTGTCCCGACGGCACACGCGTCAGTAACGCAGCTTGTTGCGCAT
TTGTTCCA
CTGGCTCAAGACCTCCAGGAGACCCTCTTCATGGGCGACTGCGGTGAAGATGCGCATGAGGTCATTCGTCTCACCTTCCACGACGCCATTGCTATCTCTCAGAGCCAGGGAC
CCGAGGCCGGCGGTGGTGCTGACGGCTCCATGCTGCTCTTCCCGACTATCGAGCCGAATTTTGAGGCGAACAACGGCATTGACGACTCCGTGAACAACCTTATCCCCTTCATGCAGAAGC
ACAACACGATCAGCGCCGCTGACCTCGTCCAGTTCGCGGGAGCCGTTGCTCTCAGTAACTGCCCC
GGCGCCCCTCGCCTCGAGTTCCTCGCTGGTCGCCCGAACACGACTATTCCCGCCG
TCGAGGGCCTCATCCCTGAGCCGCAGGACAGTGTCACCAAAATTCTACAACGCTTCGAGGACGCAGGGAACTTCTCGCCTTTTGAGGTCGTATCCCTCCTCGCCTCTCACAGTATTGCTC
GTGCGGACAAGGTTGACGAGACCATCGACGCCGCACCCTTCGATTCC
ACGCCTTTCACTTTCGACACCCAGGTCTTCCTCGAGGTCCTTCTGAAGGGAACAGGCTTCCCCGGAACGGCCA
ACAACACCGGTGAGGTCGCGTCCCCACTTCCCCTCGGCAGCGGCACGGACACCGGCGAGATGCGACTCCAGTCAGACTTTGCGCTCGCCCGCGACTCGCGCACTGCGTGCATCTGGCAGA
GCTTCGTCAACCAGCAGGAGTTCATGGCCGCGAGCTTTAAGGCTGCGATGAGCAAACTCGCGATACTCGGCCACAGTCGTAGCAACCTGATCGACTGCAGCGACGTCGTGCCGGTGCCGA
AGCCTGCGGTTAACAAGCCTGCGACGTTCCCCGCCACCAAGGGCCCGCAGGATCTCGAGCTCACGTGTACCAGCGAGAAGTTCCCGACGCTCACTACCGACC
CGGGCGCCACGGAAACCC
TTATTCCCCACTGCTCGAACGGCGGCATGTCCTGCCCTGCTGTTCAGTTCGACGGCCCGGCTTGA

Retrieve as FASTA