Entry information : RrufCIIAB02
Entry ID 8541
Creation 2011-09-26 (Christophe Dunand)
Last sequence changes 2011-10-17 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: RrufCIIAB02
Name RrufCIIAB02
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Patellariaceae Rhytidhysteron
Organism Rhytidhysteron rufulum    [TaxId: 37885 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RrufCIIAB02
start..stop
S start..stop
HpulCIIAB01 479 3e-172 1..317 1..317
GsteCIIAB01 387 4e-136 1..315 1..313
CgeoCIIAB01 373 2e-130 3..312 2..311
CberCIIAB01 335 1e-115 1..316 1..314
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8897..9314 418 N° 2 9361..9766 406 N° 3 9822..9951 130  
join(8897..9314,9361..9766,9822..9951)


exon

Literature and cross-references RrufCIIAB02
DNA ref. JGI genome:   NODE_21_length_44057_cov_44.472954 (8897..9951)
Protein sequence: RrufCIIAB02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (298)
PWM (Da):   %s   32864.33 (30825.3)  
PI (pH):   %s   7.34 (7.36) Peptide Signal:   %s   cut: 20 range:20-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYFPSSLVCLLAIATTIQSLQLSDVTAFTRDLNIPSVSAIKRSVLQSIKPRDSCPQVWFNISKQLTSDFLSGGQCNDAARAAIRAAFHDCFNGACDGSLILANECGRSDNNGLQATCDTLGSMAKQYKVGVADLIQFAGAHAIKTCPLGPTVPALVGRKDSGNANPDGQLPSAFASGDTLLSQFKAKGFDATDLAALVGAHTTAKQFNTDPSHSGASLDSTPGTWDVAFYGQTLSKTAPFTLESDKNLANHDEVGKPFRSFVGNQGGWARAFVSAMSKMSVLGVDGGAGALTDCTDALPGGTGKRDVKAAPINGRVL

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). Uncorrect prediction ofrom JGI (no prediction of exon 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATTTTCCATCTTCATTGGTTTGTCTCTTGGCCATTGCAACTACTATCCAATCCTTGCAACTATCAGATGTAACCGCTTTCACGCGAGATCTCAACATTCCTTCTGTATCCGCAATC
AAGAGATCAGTGTTGCAGTCTATTAAACCTCGAGATTCTTGTCCGCAAGTCTGGTTCAACATCTCAAAGCAACTCACGTCGGACTTTCTCTCAGGAGGTCAATGCAATGATGCCGCCCGG
GCTGCCATTCGCGCTGCCTTTCATGATTGCTTCAATGGGGCTTGTGATGGTTCTCTGATTCTTGCCAACGAATGTGGCCGATCTGATAATAACGGACTGCAAGCGACTTGCGACACACTA
GGTTCAATGGCCAAACAGTACAAGGTTGGAGTTGCTGACTTGATCCAATTCGCAGGAG
GTGAGAAATTTCAAAGGTTCCATATGAGAGTAAACTAACAGATCAGCACATGCGATAAAAAC
ATGTCCATTAGGACCTACCGTGCCTGCTTTGGTTGGCCGCAAGGACTCTGGTAACGCCAACCCCGATGGCCAGCTCCCTTCAGCTTTTGCTTCTGGGGATACACTCCTATCTCAATTCAA
AGCGAAAGGTTTTGATGCCACTGATTTAGCAGCCTTAGTCGGTGCCCATACCACAGCTAAACAATTTAACACCGATCCTTCTCATTCAGGCGCATCCCTCGACTCCACCCCTGGAACTTG
GGACGTTGCATTTTACGGCCAAACTCTCAGCAAAACCGCACCCTTCACCCTCGAAAGCGACAAGAATCTCGCCAATCACGATGAAGTGGGTAAACCATTCCGAAGCTTCGTCGGAAACCA
GGGTGGATGGGCTAGAGCGTTTGTCTCCGC
GTGAGTAACTATCTGCAAGACTCAAAATGTATGTGTAACTAATGATTACTTGCAGAATGTCAAAAATGTCCGTTCTAGGCGTTGATGGTG
GCGCGGGGGCTCTTACCGATTGTACGGACGCTCTTCCGGGTGGTACAGGAAAACGCGATGTCAAGGCTGCTCCAATCAATGGGCGCGTATTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTATTTTCCATCTTCATTGGTTTGTCTCTTGGCCATTGCAACTACTATCCAATCCTTGCAACTATCAGATGTAACCGCTTTCACGCGAGATCTCAACATTCCTTCTGTATCCGCAATC
AAGAGATCAGTGTTGCAGTCTATTAAACCTCGAGATTCTTGTCCGCAAGTCTGGTTCAACATCTCAAAGCAACTCACGTCGGACTTTCTCTCAGGAGGTCAATGCAATGATGCCGCCCGG
GCTGCCATTCGCGCTGCCTTTCATGATTGCTTCAATGGGGCTTGTGATGGTTCTCTGATTCTTGCCAACGAATGTGGCCGATCTGATAATAACGGACTGCAAGCGACTTGCGACACACTA
GGTTCAATGGCCAAACAGTACAAGGTTGGAGTTGCTGACTTGATCCAATTCGCAGGAG
CACATGCGATAAAAACATGTCCATTAGGACCTACCGTGCCTGCTTTGGTTGGCCGCAAGGAC
TCTGGTAACGCCAACCCCGATGGCCAGCTCCCTTCAGCTTTTGCTTCTGGGGATACACTCCTATCTCAATTCAAAGCGAAAGGTTTTGATGCCACTGATTTAGCAGCCTTAGTCGGTGCC
CATACCACAGCTAAACAATTTAACACCGATCCTTCTCATTCAGGCGCATCCCTCGACTCCACCCCTGGAACTTGGGACGTTGCATTTTACGGCCAAACTCTCAGCAAAACCGCACCCTTC
ACCCTCGAAAGCGACAAGAATCTCGCCAATCACGATGAAGTGGGTAAACCATTCCGAAGCTTCGTCGGAAACCAGGGTGGATGGGCTAGAGCGTTTGTCTCCGC
AATGTCAAAAATGTCC
GTTCTAGGCGTTGATGGTGGCGCGGGGGCTCTTACCGATTGTACGGACGCTCTTCCGGGTGGTACAGGAAAACGCGATGTCAAGGCTGCTCCAATCAATGGGCGCGTATTATGA

Retrieve as FASTA