1. Browse the Database
  2. View Redoxidase
Entry information : AcoPrx14 (AcoGoldSmith_v1.007746m)
Entry ID 8578
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx14 (AcoGoldSmith_v1.007746m)
Name (synonym) AcoPrx14 (AcoGoldSmith_v1.007746m)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx14
start..stop		 S start..stop
MePrx10 529 0 17..346 18..347
RcPrx49 528 0 12..346 16..352
CroPrx51 524 0 5..347 1..352
NnPrx05 520 0 29..346 78..396
Gene structure Fichier Exons►


exon

Literature and cross-references AcoPrx14 (AcoGoldSmith_v1.007746m)
DNA ref. Phytozome 12:   scaffold_5 (1423496..1426743)
Protein sequence: AcoPrx14 (AcoGoldSmith_v1.007746m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (317)
PWM (Da):   %s   38390.47 (34822.7)  
PI (pH):   %s   9.18 (9.18) Peptide Signal:   %s   cut: 32 range:32-348
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSMSMFMQSSFFTNSTLIILLLVMLIGTSQSSSANTTTHRHPLKLDFYSKSCPHVEQLVGAVTSQQFKESPVSAPATIRLFFHDCFVQGCDASILISTKPGSKALAEKDAQDNKHLAVEA
FDTIKKAKALIESKCPGVVSCADILAIAARDFVHLAGGPYYQVKTGRWDGKISMASKVSYNIPRANSTIDELLKLFASKGLSLQDLVALSGAHTIGFSHCEHFVRRLYDYRGTKKADPAM
DPRLQKALKMSCSQYGGNPEVVVPFDVSTPFTFDHAYYGNLENNMGLLATDQALFLDPRTRPIVQALGSNKQKFFQAFSEAMDKMGSIEVKRGKKHGERRKECSQHLQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA ►
Send to BLAST
CDS►
Send to BLAST