Entry information : AcoPrx16 (AcoGoldSmith_v1.007908m)
Entry ID 8579
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx16 (AcoGoldSmith_v1.007908m)
Name (synonym) AcoPrx16 (AcoGoldSmith_v1.007908m)
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx16
start..stop
S start..stop
AfpPrx05 701 0 1..342 1..342
NnPrx06 454 1.91e-161 3..341 2..343
VvPrx19 449 5.63e-160 12..341 11..333
PtPrx17 434 1.06e-153 9..341 8..337
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8579' 'complement(join(2062467..2063042,2063204..2063395,2063491..2063751))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2063491..2063751 259 N° 2 2063204..2063395 190 N° 3 2062467..2063042 574  
complement(join(2062467..2063042,2063204..2063395,2063491..2063751))


exon

Literature and cross-references AcoPrx16 (AcoGoldSmith_v1.007908m)
DNA ref. Phytozome 12:   scaffold_22 (2063751..2062467)
Protein sequence: AcoPrx16 (AcoGoldSmith_v1.007908m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (311)
PWM (Da):   %s   37204.87 (33654.1)  
PI (pH):   %s   4.28 (4.18) Peptide Signal:   %s   cut: 32 range:32-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMTNFLPCSSVVLRLAIAFLCFCMSDSLKSQECFEDNAGSFDVNFYQTSCPQAESIIFSWVAKAVKEDPRMAASLLRLHFHDCFVQGCDASVLLDDTETFTGEKTAAPNLNSIRGFEVI
DSIKCELESACPQTVSCADILTTVARDSVVLSGGPGWDVQFGRRDSFTANKTAANTNIPNPNSDIATIVSKFENVGLSFNDMVALAGAHTIGRARCSSFNSRLKDSPNSEEPDVNPVFLS
SLEQICSDSENENTTLTFLDLATPATFDNQYYVNLVSGKGLLASDHALGSIDSPARDIVESYAQNPSSFFEDFRMSIVKMGSIDPLLGDQGEIRQNCRSVNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATGACCAACTTCCTCCCTTGCTCTTCAGTTGTTCTGAGACTTGCTATCGCCTTTTTGTGCTTCTGCATGAGTGACTCCTTGAAATCCCAAGAGTGTTTTGAGGATAATGCTGGC
TCTTTCGATGTCAATTTCTACCAAACTAGTTGTCCTCAAGCAGAGTCTATTATTTTCTCTTGGGTGGCCAAAGCAGTGAAAGAAGATCCACGAATGGCGGCTTCGCTTCTGCGTCTTCAT
TTTCACGACTGCTTTGTTCAG
GTAATTATTGTCATTGATTAAAGAACTCCAGTGAATCATATGATTTTGTTACAAACTTCACACTGATATACATGTAACTACTGTAATTGTTGTAGGGGG
ATGCGATGCTTCGGTTTTGTTGGATGATACAGAAACATTCACTGGTGAAAAGACAGCTGCTCCCAACCTGAATTCCATACGAGGATTTGAAGTGATAGATTCGATCAAATGTGAACTTGA
ATCAGCTTGTCCTCAAACTGTATCATGTGCTGATATACTCACAACTGTGGCGAGAGACTCTGTTGTTCTG
GTACGTCAGATTGGTCATTGGTGGACATGTTGTAGTGTACATGTTCCTCT
CTAGTAGACAGTTGTAGTGTACATGTTCTCATTTTCATGTAAACTTGTAGTTCTAGTAAGTTTTTGTTCTGTTTTGGATGATGAATTTGCATCAATTGTGTGCAATGGCAGTCTCAGGTG
GACCAGGCTGGGATGTCCAGTTCGGAAGAAGGGATAGCTTTACTGCCAACAAAACTGCAGCAAACACAAATATTCCAAACCCAAATTCTGACATTGCAACTATTGTGTCCAAATTCGAGA
ATGTAGGGCTCAGCTTCAACGATATGGTTGCCCTCGCAGGTGCACACACTATCGGAAGGGCTCGATGTTCATCATTCAACTCTCGCTTAAAAGACAGTCCCAACTCCGAGGAACCAGATG
TCAACCCAGTTTTCCTCTCGTCCTTGGAACAAATTTGCTCAGATTCTGAAAATGAGAATACAACATTAACATTTCTCGATTTGGCAACACCAGCCACATTTGACAATCAGTACTACGTCA
ACCTTGTTTCAGGTAAGGGCCTCCTGGCATCCGACCATGCACTAGGGTCAATAGACAGTCCTGCACGTGACATTGTAGAGTCCTACGCACAAAACCCTTCCTCTTTCTTCGAAGATTTCC
GTATGTCAATCGTGAAGATGGGAAGCATAGATCCACTTCTGGGAGACCAGGGTGAGATCCGTCAGAACTGCCGATCTGTCAATAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATGACCAACTTCCTCCCTTGCTCTTCAGTTGTTCTGAGACTTGCTATCGCCTTTTTGTGCTTCTGCATGAGTGACTCCTTGAAATCCCAAGAGTGTTTTGAGGATAATGCTGGC
TCTTTCGATGTCAATTTCTACCAAACTAGTTGTCCTCAAGCAGAGTCTATTATTTTCTCTTGGGTGGCCAAAGCAGTGAAAGAAGATCCACGAATGGCGGCTTCGCTTCTGCGTCTTCAT
TTTCACGACTGCTTTGTTCAG
GGATGCGATGCTTCGGTTTTGTTGGATGATACAGAAACATTCACTGGTGAAAAGACAGCTGCTCCCAACCTGAATTCCATACGAGGATTTGAAGTGATA
GATTCGATCAAATGTGAACTTGAATCAGCTTGTCCTCAAACTGTATCATGTGCTGATATACTCACAACTGTGGCGAGAGACTCTGTTGTTCTG
TCAGGTGGACCAGGCTGGGATGTCCAG
TTCGGAAGAAGGGATAGCTTTACTGCCAACAAAACTGCAGCAAACACAAATATTCCAAACCCAAATTCTGACATTGCAACTATTGTGTCCAAATTCGAGAATGTAGGGCTCAGCTTCAAC
GATATGGTTGCCCTCGCAGGTGCACACACTATCGGAAGGGCTCGATGTTCATCATTCAACTCTCGCTTAAAAGACAGTCCCAACTCCGAGGAACCAGATGTCAACCCAGTTTTCCTCTCG
TCCTTGGAACAAATTTGCTCAGATTCTGAAAATGAGAATACAACATTAACATTTCTCGATTTGGCAACACCAGCCACATTTGACAATCAGTACTACGTCAACCTTGTTTCAGGTAAGGGC
CTCCTGGCATCCGACCATGCACTAGGGTCAATAGACAGTCCTGCACGTGACATTGTAGAGTCCTACGCACAAAACCCTTCCTCTTTCTTCGAAGATTTCCGTATGTCAATCGTGAAGATG
GGAAGCATAGATCCACTTCTGGGAGACCAGGGTGAGATCCGTCAGAACTGCCGATCTGTCAATAATTGA

Retrieve as FASTA