Entry information : AcoPrx46 (AcoGoldSmith_v1.010000m)
Entry ID 8600
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2012-06-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-11 (Christophe Dunand)
Peroxidase information: AcoPrx46 (AcoGoldSmith_v1.010000m)
Name (synonym) AcoPrx46 (AcoGoldSmith_v1.010000m)
Class Class III peroxidase    [Orthogroup: Prx117]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx46
start..stop
S start..stop
AfpPrx15 704 0 1..354 1..354
AcoPrx10 664 0 1..354 1..354
AcoPrx07 561 0 26..352 25..352
AfpPrx17 515 0 1..354 1..346
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3548212..3548460 249 N° 2 3548766..3548960 195 N° 3 3549048..3549668 621  
join(3548212..3548460,3548766..3548960,3549048..3549668)


exon

Literature and cross-references AcoPrx46 (AcoGoldSmith_v1.010000m)
DNA ref. Phytozome 12:   scaffold_23 (3548212..3549667)
Protein sequence: AcoPrx46 (AcoGoldSmith_v1.010000m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354 (326)
PWM (Da):   %s   37952.13 (35114.6)  
PI (pH):   %s   7.38 (7.34) Peptide Signal:   %s   cut: 29 range:29-354
Sequence 395
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSSSASFISLLLVSSFLLGSHLSLTSAQATPPLVAGLSYDFHATNCPSLETTIREYLREIFSSDFGVAAGLLRVHFHDCFVQGCDGSVLLAGSASGPGEQAAPPNLTLRPRAFVIINELRNRIHRACGAIVSCADITALCARDAVFLTGGPDYRVPLGRRDGLTFATRDATIANLPFFGSRVPTLISDFARKNLDVTDLVALSGGHSIGRSNCVSFVGRLYPTRDPTLETNFANNLTRVCPTNTSPGLTALDVRTPIxFDNQYFVNLVNRQGLFVSDQDLFTDNTTSPIVISYANNQSLFFQRFAFSMIKMSMINVTTGTQGEIRTNCSARNTATSYLSNAVINEEQGKSASY

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACTTCTTCTTCTGCTTCATTCATCTCTCTTCTCTTAGTATCTTCTTTTCTTCTTGGTTCTCATTTGTCTCTAACAAGTGCACAAGCCACACCTCCTTTGGTTGCAGGACTTTCATATG
ATTTCCATGCCACTAACTGTCCATCTTTAGAAACCACTATTAGAGAATACCTTAGGGAGATCTTCAGCAGTGATTTTGGTGTTGCTGCAGGTTTGCTTCGTGTTCATTTCCATGATTGCT
TTGTTCAG
GTACTTGGTTATCTTTGATTCATCATATCGGCTGTTTTTCATATGATTATATGTTGTTTAGGTAAAATACTTATTATATATGGTAAATGCTGTTGAATCTAATATATATAGT
TTAGTCAAGATCAATGATCCAAAAAGGCTATATAATCATGAGTTTGGCAAGCTGACTTCATTTTTCACCAATTCACTTATTTGAACTGATTCATCGATATCTTACTGTTCGGATATATAT
ATAACATAACATCAATATATAGTTACAATATGATTATTATTTGTGATTGATATATGTAGATGTTTATGGGCAGGGATGCGATGGCTCAGTGCTGCTAGCTGGGTCAGCAAGTGGTCCTGG
TGAACAAGCAGCACCACCAAACTTGACGTTGAGACCAAGAGCATTTGTTATCATCAATGAACTTCGTAACCGCATCCATAGAGCTTGTGGTGCAATCGTTTCATGTGCTGATATTACTGC
CCTTTGTGCTCGTGACGCTGTTTTTCTG
GTAACCGGCCCTCGCAACTGATATCTTCTATTTAATTGTAAACTCAATTGAAGAAACAACAAAATAATTCGTGTTCATGGTGTGCAGACTGG
TGGCCCAGATTATCGAGTTCCTCTTGGTAGGCGTGATGGGTTAACTTTTGCAACAAGAGATGCAACAATAGCCAACCTACCATTTTTCGGTTCAAGGGTACCAACGCTTATTTCTGATTT
TGCCCGTAAGAACTTGGACGTAACTGATCTTGTTGCACTCTCTGGTGGTCACTCCATTGGCCGTTCAAACTGTGTTTCTTTTGTAGGCCGATTGTACCCTACCCGAGACCCTACTCTGGA
GACAAATTTTGCAAATAACCTTACACGTGTTTGCCCCACAAACACTTCTCCTGGACTAACTGCTTTAGATGTTCGAACTCCCATATANTTCGACAATCAATACTTTGTCAACCTAGTGAA
TAGACAAGGCCTATTCGTCTCCGACCAAGACTTGTTCACTGACAATACTACCAGTCCGATTGTCATAAGTTACGCAAATAATCAATCTTTGTTTTTCCAAAGATTTGCATTTTCCATGAT
CAAGATGAGTATGATAAATGTTACAACTGGAACACAAGGTGAGATACGTACTAATTGCTCAGCTCGCAATACTGCTACATCATATCTGTCAAATGCTGTGATCAATGAAGAACAAGGAAA
GAGTGCATCATACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACTTCTTCTTCTGCTTCATTCATCTCTCTTCTCTTAGTATCTTCTTTTCTTCTTGGTTCTCATTTGTCTCTAACAAGTGCACAAGCCACACCTCCTTTGGTTGCAGGACTTTCATATG
ATTTCCATGCCACTAACTGTCCATCTTTAGAAACCACTATTAGAGAATACCTTAGGGAGATCTTCAGCAGTGATTTTGGTGTTGCTGCAGGTTTGCTTCGTGTTCATTTCCATGATTGCT
TTGTTCAG
GGATGCGATGGCTCAGTGCTGCTAGCTGGGTCAGCAAGTGGTCCTGGTGAACAAGCAGCACCACCAAACTTGACGTTGAGACCAAGAGCATTTGTTATCATCAATGAACTTC
GTAACCGCATCCATAGAGCTTGTGGTGCAATCGTTTCATGTGCTGATATTACTGCCCTTTGTGCTCGTGACGCTGTTTTTCTG
ACTGGTGGCCCAGATTATCGAGTTCCTCTTGGTAGGC
GTGATGGGTTAACTTTTGCAACAAGAGATGCAACAATAGCCAACCTACCATTTTTCGGTTCAAGGGTACCAACGCTTATTTCTGATTTTGCCCGTAAGAACTTGGACGTAACTGATCTTG
TTGCACTCTCTGGTGGTCACTCCATTGGCCGTTCAAACTGTGTTTCTTTTGTAGGCCGATTGTACCCTACCCGAGACCCTACTCTGGAGACAAATTTTGCAAATAACCTTACACGTGTTT
GCCCCACAAACACTTCTCCTGGACTAACTGCTTTAGATGTTCGAACTCCCATATANTTCGACAATCAATACTTTGTCAACCTAGTGAATAGACAAGGCCTATTCGTCTCCGACCAAGACT
TGTTCACTGACAATACTACCAGTCCGATTGTCATAAGTTACGCAAATAATCAATCTTTGTTTTTCCAAAGATTTGCATTTTCCATGATCAAGATGAGTATGATAAATGTTACAACTGGAA
CACAAGGTGAGATACGTACTAATTGCTCAGCTCGCAATACTGCTACATCATATCTGTCAAATGCTGTGATCAATGAAGAACAAGGAAAGAGTGCATCATACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCTT CTTCTGCTTC ATTCATCTCT CTTCTCTTAG TATCTTCTTT TCTTCTTGGT TCTCATTTGT CTCTAACAAG TGCACAAGCC ACACCTCCTT TGGTTGCAGG ACTTTCATAT  GATTTCCATG CCACTAACTG TCCATCTTTA GAAACCACTA TTAGAGAATA CCTTAGGGAG ATCTTCAGCA GTGATTTTGG TGTTGCTGCA GGTTTGCTTC GTGTTCATTT CCATGATTGC  TTTGTTCAGG GATGCGATGG CTCAGTGCTG CTAGCTGGGT CAGCAAGTGG TCCTGGTGAA CAAGCAGCAC CACCAAACTT GACGTTGAGA CCAAGAGCAT TTGTTATCAT CAATGAACTT  CGTAACCGCA TCCATAGAGC TTGTGGTGCA ATCGTTTCAT GTGCTGATAT TACTGCCCTT TGTGCTCGTG ACGCTGTTTT TCTGACTGGT GGCCCAGATT ATCGAGTTCC TCTTGGTAGG  CGTGATGGGT TAACTTTTGC AACAAGAGAT GCAACAATAG CCAACCTACC ATTTTTCGGT TCAAGGGTAC CAACGCTTAT TTCTGATTTT GCCCGTAAGA ACTTGGACGT AACTGATCTT  GTTGCACTCT CTGGTGGTCA CTCCATTGGC CGTTCAAACT GTGTTTCTTT TGTAGGCCGA TTGTACCCTA CCCGAGACCC TACTCTGGAG ACAAATTTTG CAAATAACCT TACACGTGTT  TGCCCCACAA ACACTTCTCC TGGACTAACT GCTTTAGATG TTCGAACTCC CATATAnTTC GACAATCAAT ACTTTGTCAA CCTAGTGAAT AGACAAGGCC TATTCGTCTC CGACCAAGAC  TTGTTCACTG ACAATACTAC CAGTCCGATT GTCATAAGTT ACGCAAATAA TCAATCTTTG TTTTTCCAAA GATTTGCATT TTCCATGATC AAGATGAGTA TGATAAATGT TACAACTGGA 
ACACAAGGTG AGATACGTAC TAATTGCTCA GCTCGCAATA CTGCTACATC ATATCTGTCA AATGCTGTGA TCAATGAAGA ACAAGGAAAG AGTGCATCAT ACTAA 

Retrieve as FASTA