1. Browse the Database
  2. View Redoxidase
Entry information : AcoPrx79 (AcoGoldSmith_v1.022187m)
Entry ID 8625
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2011-12-14 (Qiang Li)
Peroxidase information: AcoPrx79 (AcoGoldSmith_v1.022187m)
Name (synonym) AcoPrx79 (AcoGoldSmith_v1.022187m)
Class Class III peroxidase     [Orthogroup: Prx026]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx79
start..stop		 S start..stop
AcoPrx09 275 8.35e-94 1..136 228..363
AfpPrx04 273 8.33e-93 1..136 228..363
AfpPrx02 220 1.34e-72 1..136 179..311
AcoPrx05 220 6.95e-72 1..136 233..365
Gene structure Fichier Exons►


exon

Literature and cross-references AcoPrx79 (AcoGoldSmith_v1.022187m)
DNA ref. Phytozome 12:   scaffold_20 (1656350..1657617)
Protein sequence: AcoPrx79 (AcoGoldSmith_v1.022187m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18760.37 Transmb domain:   %s   o352-374i495-517o537-559i719-736o
PI (pH):   %s   8.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
IGVAHCQFFRSRLYNFSGTGLPDPSLEPESLHLMRSRRQSSDDSKSHTEEPGVSMGYDGATGPVFGTNYNNTLVLGKGILHADQQLMAGEGTASWVEAYASDESLFRRDFAQVMMKLSSL
RVLTKPLGQIRLNCSRNFLCPSLFGSFATLIRVGCKFANSAENFQLLRLIK

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (5' end is missing which has not been found yet).
DNA ►
Send to BLAST
CDS►
Send to BLAST