1. Browse the Database
  2. View Redoxidase
Entry information : AcoPrx86 (AcoGoldSmith_v1.024499m)
Entry ID 8631
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AcoPrx86 (AcoGoldSmith_v1.024499m)
Name (synonym) AcoPrx86 (AcoGoldSmith_v1.024499m)
Class Class III peroxidase    [Orthogroup: Prx307]
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx86
start..stop		 S start..stop
AcoPrx28 604 0 1..327 1..326
AfpPrx03 498 1.25e-179 1..327 1..325
AcoPrx30 496 9.1e-179 1..327 1..325
NnPrx23 479 3.8e-172 1..327 1..326
Gene structure Fichier Exons►


exon

Literature and cross-references AcoPrx86 (AcoGoldSmith_v1.024499m)
DNA ref. Phytozome 12:   scaffold_47 (942539..940913)
Protein sequence: AcoPrx86 (AcoGoldSmith_v1.024499m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (304)
PWM (Da):   %s   35620.23 (33111.8) Transmb domain:   %s   i7-24o
PI (pH):   %s   7.9 (7.06) Peptide Signal:   %s   cut: 25 range:25-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKKSCFVKIILCVLGFLIGSTVADLKMGFYDKNCPNAEKIVLGY
VKKHISNVPSLAAPLLRMAFHDCFVRGCDASVLLNATLNNQAAEKDARPNLSLRGFDFIDEVKSLLEAECPDIVSCADIISLVARDSVVTMGGPYWKVPTGRRDGTISRASEALSNLPGANENFNALQTKFELKGLNIKDLVLLSG
AHTIGIAHCSPFSNRIYNFTGVGDQDPALDNDYAINLRANKCKTPTDITTIVEMDPGSSKHFDLSYYKLLVKKRGLFQSDATLTTDSSSIAVINQLLEKSPLYFFAEFAKSMEKMGDVGV
KTGTDGQIRKHCALVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from phytozome (5' end is missing).
DNA ►
Send to BLAST
CDS►
Send to BLAST