Entry information : AcoPrx[P]59 (AcoGoldSmith_v1.015999m)
Entry ID 8643
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: AcoPrx[P]59 (AcoGoldSmith_v1.015999m)
Name (synonym) AcoPrx[P]59 (AcoGoldSmith_v1.015999m)
Class Class III peroxidase     [Orthogroup: Prx029]*
Taxonomy Eukaryota Viridiplantae Streptophyta Ranunculaceae Aquilegia
Organism Aquilegia coerulea     [TaxId: 218851 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcoPrx[P]59
start..stop
S start..stop
AcoPrx76 419 2.57e-150 1..218 66..301
AcoPrx16 204 2.69e-65 1..218 85..341
AfpPrx05 204 2.76e-65 1..218 85..341
CclPrx118 192 1.94e-60 1..218 82..335
Gene structure Fichier Exons


exon

Literature and cross-references AcoPrx[P]59 (AcoGoldSmith_v1.015999m)
DNA ref. Phytozome 12:   scaffold_49 (837689..838908)
Protein sequence: AcoPrx[P]59 (AcoGoldSmith_v1.015999m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   235 (298)
PWM (Da):   %s   25674.97 (31903.4)  
PI (pH):   %s   6.5 (9.13) Peptide Signal:   %s   cut: 27 range:27-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
FSQGCDASVLLDDTEHHAGEKTALPNDQSLRGFEVIDTIKAELEKACPRTVSCSDVIAAVARDSVVLSGGPRWSVEFGRRDIITVANNVTVLQGLPSPNSELADLLATIGSARCFFLKGQ
RPNSCSRNETHASLDQTPKVFDNNYYLALLRKNMNGGFFQSDNALVKFTPALDLVHIYATNSTAFFDDFATSMLKMGRIAPLLASEGEIRxINCRMVNQLRIVTVRNRFQDLNFD

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome (Gaps in frame; 5' end is missing).
DNA
Send to BLAST
CDS
Send to BLAST