Entry information : CclPrx58(clementine0.9_018254m)
Entry ID 8649
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-03 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-08-31 (Christophe Dunand)
Peroxidase information: CclPrx58(clementine0.9_018254m)
Name CclPrx58(clementine0.9_018254m)
Class Class III peroxidase    [Orthogroup: Prx037]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx58
start..stop
S start..stop
CsPrx03 437 8e-157 10..248 1..241
NtPrx96-1A 401 2.18e-141 4..322 3..329
NtPrx96-1B 396 2.13e-139 28..322 35..329
GbPrx53 370 5.44e-129 24..322 33..331
Gene structure Fichier Exons


exon

Literature and cross-references CclPrx58(clementine0.9_018254m)
DNA ref. Phytozome 12:   scaffold_33 (1386416..1385004)
EST ref. GenBank:   FC920886.1 [5' end]
Protein sequence: CclPrx58(clementine0.9_018254m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (291)
PWM (Da):   %s   35339.73 (31198.7) Transmb domain:   %s   i11-33o
PI (pH):   %s   6.04 (7.44) Peptide Signal:   %s   cut: 33 range:33-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMGLRELTMVLILWGSCCLFAGGNGVLVLHFYKKSCPSAEMPVKEEMKRNMLSDISSAAAILRLDFHDCQVQGCDGSILLGNSNGITTETLSDKNFGIRKVDIINEIKSSLETICPETV
SCADFIQLAARDAVLVSGGPYIEVLTGRRDAVSGKKERADNQLPTYDISVSEFxxVFLQKNISLEDGVALMGSHTLGVSHCRNFQNRLWPIKDDTLSLAFSGMLEMICSNPTLSDISFAQ
NDATTLYFDNQYFIDIQSGRGLLKIDSEIAKDPRTQPYVTAFGQNTQHFFDRFSSGFLKLSNYKVLVGGKGEIRRDCRFINS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Short PS was missing which has been completed, frame shift in exon 3).
DNA
Send to BLAST