Entry information : CclPrx58 (clementine0.9_018254m)
Entry ID 8649
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-03 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: CclPrx58 (clementine0.9_018254m)
Name (synonym) CclPrx58 (clementine0.9_018254m)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx58
start..stop
S start..stop
CsPrx03 444 2e-159 10..249 1..241
GbPrx53 345 2e-119 13..323 22..331
PtaPrx97 338 9e-117 8..323 10..327
PabPrx206 335 2e-115 22..323 34..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1386198..1386416 219 N° 2 1385919..1386107 189 N° 3 1385710..1385820 111 N° 4 1385004..1385399 396
complement(join(1385004..1385399,1385710..1385820,1385919..1386107,1386198..1386 416))


exon

Literature and cross-references CclPrx58 (clementine0.9_018254m)
DNA ref. Phytozome 12:   scaffold_33 (1386416..1385004)
Protein sequence: CclPrx58 (clementine0.9_018254m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323
PWM (Da):   %s   35764.98 Transmb domain:   %s   i11-33o
PI (pH):   %s   6.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMGLRELTMVLILWGSCCLFAGGNGVLVLHFYKKSCPSAEMPVKEEMKRNMLSDISSAAAILRLDFHDCQVQGCDGSILLGNSNGITTETLSDKNFGIRKVDIINEIKSSLETICPETVSCADFIQLAARDAVLVSGGPYIEVLTGRRDAVSGKKERADNQLPTYDISVSEFYISFLKDKELTIFLSANSLGSHTLGVSHCRNFQNRLWPIKDDTLSLAFSGMLEMICSNPTLSDISFAQNDATTLYFDNQYFIDIQSGRGLLKIDSEIAKDPRTQPYVTAFGQNTQHFFDRFSSGFLKLSNYKVLVGGKGEIRRDCRFINS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (Short PS was missing which has been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAATGGGATTAAGAGAATTGACAATGGTGTTGATTTTGTGGGGTTCTTGCTGCTTGTTTGCAGGTGGAAATGGGGTACTTGTGCTTCACTTTTATAAAAAGAGTTGCCCTAGTGCA
GAAATGCCAGTAAAAGAGGAGATGAAAAGAAATATGCTGAGTGATATTTCTTCTGCTGCTGCCATTCTTAGACTGGATTTTCATGATTGTCAAGTCGAT
GTAAATTTTTTTTTTCTTGTC
TCACAAGTAATATATTTATATGATCTTTGGTTTCCAAGCTTTGCTTATGTTTGTTACATTTTACTACAGGGTTGTGATGGATCAATTCTTCTCGGAAACTCAAACGGGATTACAACAGAA
ACATTATCGGACAAGAATTTCGGAATCCGGAAGGTTGATATTATCAATGAGATAAAGAGTTCCCTTGAAACAATTTGTCCTGAAACAGTTTCTTGTGCTGATTTTATCCAGTTAGCTGCA
AGGGATGCTGTATACCTG
GTGAGCTACATCAGTTTCTTGAAAGACAAGGAAACTTTGAAAAAAATTCTATGAACTTATATTTGTACTCAAGAAACTTTTTTGTTTCCACTTTCCAGTCTG
GAGGGCCATACATAGAGGTTTTAACTGGAAGAAGAGATGCCGTTTCGGGAAAGAAGGAGAGAGCCGATAATCAGCTTCCGACTTACGATATTTCTGTCAGCGAATTC
ACTGGGTTTTCCT
TCAGAAGAACATTAGTTTGGAAGATGGAGTTGCACTCATGGGTACACAACTTGTACTAAAAATAAAATTCACCTTTCTTCCAAATGCTAATAATGTGTGCATTTTAAAAAAAATTTATTT
CCCCTTTTCGCAATACGTTGTACATTGGATTGTTGGTCCAGATTTTAAAAGATGCAGAGGTTTATGAGAGAGACTGACAATAAACATGCAGTATGGAGCCAAATTGGAAGATGGCATGGC
CATCGGATATGTTATGTTAATATGTTACATTTTTCTAACTCTTGTTATGTGTTTCCAGGATCTCACACTCTAGGCGTAAGCCATTGCCGGAACTTCCAAAACAGGCTGTGGCCGATAAAG
GATGATACATTGTCACTAGCATTTTCAGGAATGCTGGAGATGATTTGCAGCAATCCTACGTTATCTGATATATCATTTGCCCAAAATGATGCTACTACTTTATATTTTGATAATCAATAC
TTCATTGACATTCAAAGTGGAAGAGGGTTACTGAAGATTGATTCTGAGATTGCCAAAGATCCCAGAACACAGCCTTATGTGACTGCATTTGGACAGAACACACAACACTTCTTTGATAGG
TTCTCATCTGGGTTTTTGAAGCTGTCAAATTACAAGGTTTTAGTAGGAGGAAAGGGAGAGATTAGGAGAGATTGCAGATTTATTAACAGTTAG

Retrieve as FASTA