1. Browse the Database
  2. View Redoxidase
Entry information : CclPrx04 (clementine0.9_014456m)
Entry ID 8651
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-12-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx04 (clementine0.9_014456m)
Name (synonym) CclPrx04 (clementine0.9_014456m)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx04
start..stop		 S start..stop
CsPrx57 699 0 1..350 1..350
CclPrx68 523 0 1..350 1..349
CsPrx52 518 0 1..350 1..350
CclPrx05 517 0 1..350 1..350
Gene structure Fichier Exons►


exon

Literature and cross-references CclPrx04 (clementine0.9_014456m)
Literature Forment,J. et al., Development of a citrus genome-wide EST collection and cDNA microarray as resources for genomic studies, Plant Mol. Biol. 57 (3), 375-391 (2005).
DNA ref. Phytozome 12:   scaffold_31 (1052311..1049597)
Protein sequence: CclPrx04 (clementine0.9_014456m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (325)
PWM (Da):   %s   37237.2 (34616.9)  
PI (pH):   %s   4.31 (4.33) Peptide Signal:   %s   cut: 26 range:26-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPLRYLLAAAVLSAFVLDESSSQAQLTPDFYNTTCPNASNIILG
VLQNAFNSDIRITASLIRLHFHDCFVNGCDGSILLDNVANDTSIDSEKFSMANNNSARGFEVVDAMKAALESACPGIVSCADILAIASEQSVNLSGGPSWTVPLGRRDGRTANRSLADQNLPTPFQTLDLLKGRFTNVGLNDNTDLV
ALSGAHTFGRAQCQFFSQRLFNFNGTGNPDPTLNATLLAQLQQLCPQGGNGSVLTNLDLSTPDGFDNDYFSNLQANNGLLQSDQELFSTPGADTIPIVNNFSSNETAFFESFAVSMIRMG
NLSLLTGTQGEIRSNCRRVNANNLSTRSSSDGGLVSSI

Retrieve as FASTA  
Remarks Complete sequence from genomic. 3 ESTs. Assembly by PeroxiBase Team.
DNA ►
Send to BLAST
CDS►
Send to BLAST