1. Browse the Database
  2. View Redoxidase
Entry information : CclPrx07 (clementine0.9_015819m)
Entry ID 8654
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx07 (clementine0.9_015819m)
Name (synonym) CclPrx07 (clementine0.9_015819m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx07
start..stop		 S start..stop
CsPrx15 662 0 1..323 1..323
MePrx83 519 0 8..323 1..316
PpePrx20 512 0 6..323 7..325
NnPrx73 512 0 1..323 1..321
Gene structure Fichier Exons►


exon

Literature and cross-references CclPrx07 (clementine0.9_015819m)
Literature Forment,J. et al., Development of a citrus genome-wide EST collection and cDNA microarray as resources for genomic studies, Plant Mol. Biol. 57 (3), 375-391 (2005).
DNA ref. Phytozome 12:   scaffold_81 (457411..454919)
Protein sequence: CclPrx07 (clementine0.9_015819m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (297)
PWM (Da):   %s   34466.5 (31774.1)  
PI (pH):   %s   10.03 (9.93) Peptide Signal:   %s   cut: 27 range:27-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSFSSLMVTLALGFLVVFTGKSSAQLSTNFYSKTCPKLLNTVK
SAVQSAVSKERRMGASLLRLHFHDCFVNGCDGSILLDDTSSFTGEKTSGPNINSARGFEVVDDIKSKVEKVCPGVVSCADILAIAARHSVAILGGPSWNVKLGRRDSKTASLAAANSGVIPPPTSTLSNLINRFQAKGLSAKDMVALSGAHTIGQARCVAFRNRIYNESNIESSFAKNRRGNCPRATGSGDNNLAPLDFQSPNKFDNQYYKHLLNQKGLLHSDQILFNGGSTDSLVSTYASNSKTFNSDFAAAMIKMGDISPLTGSIG
EIRKNCRRPN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST. Assembly ba PeroxiBase Team.
DNA ►
Send to BLAST
CDS►
Send to BLAST