Entry information : CclPrx38 (clementine0.9_015669m)
Entry ID 8658
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx38 (clementine0.9_015669m)
Name (synonym) CclPrx38 (clementine0.9_015669m)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx38
start..stop
S start..stop
CsPrx05 644 0 1..313 14..326
GrPrx39 559 0 1..313 11..323
GhPrx39 558 0 1..313 11..323
MePrx119 535 0 1..313 6..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3425214..3425423 210 N° 2 3424926..3425114 189 N° 3 3424576..3424738 163 N° 4 3423775..3424154 380
complement(join(3423775..3424154,3424576..3424738,3424926..3425114,3425214..3425 423))


exon

Literature and cross-references CclPrx38 (clementine0.9_015669m)
DNA ref. Phytozome 12:   scaffold_23 (3425423..3423775)
Protein sequence: CclPrx38 (clementine0.9_015669m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (296)
PWM (Da):   %s   34229.86 (32392.9)  
PI (pH):   %s   5.21 (5.20) Peptide Signal:   %s   cut: 18 range:18-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKLLSVFLFMEVIASGFRFGVDGLRMDYYIMTCPFGEQIVTNAVDRALDDDPTLAAALVRMHFHDCFIEGCDGSVLIDSTQDNKAEKDSPGNLSLRGYEVIDDAKNQLEEHCPGVVSCADIIAMAARDAIFWAGGPIYDIPKGRKDGRRSKIEDTINLPFPTFNASELIRAFGQRGFTAQEMVALSGAHTIGVARCSSFKSRLTGVDPTLDSDFAKTLSKTCSAGDNAEQPFDATRNDFDNLYFNALIRKAGVLFSDQTLLTNAKTRAAVNGYAMNQAMFFLDFQQAMVKMGMVDVKEGGKGEVRHNCRKIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (A short extra seq MLLKSRMSLAKLV has been removed from 5' end).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGTTGCTTAGTGTTTTTTTGTTCATGGAAGTGATAGCAAGTGGTTTTAGGTTCGGAGTTGATGGACTTCGAATGGATTACTACATCATGACTTGCCCATTTGGTGAACAAATT
GTGACAAATGCTGTCGACAGGGCTCTCGACGATGATCCCACTCTTGCTGCTGCCCTTGTTAGAATGCATTTCCATGACTGTTTCATTGAG
GTCCTCTAATATTTTTTTTTTCAGTTTGGT
CCTTTCTTTATTTATTTATTTGATATCATACGAAAGAAACTAATGCTTTGTTTTTTTTTCCTTTTTAAGGGGTGTGACGGGTCAGTTCTGATTGACTCAACGCAGGACAACAAAGCAGAA
AAGGACTCTCCCGGCAATTTGAGCCTGCGGGGCTATGAAGTTATAGATGATGCTAAAAATCAGCTTGAAGAGCATTGTCCAGGCGTCGTTTCATGTGCCGATATCATTGCTATGGCTGCT
AGAGATGCTATTTTTTGG
GTAATGAAATTGATTAAGCCTCTAATGTCGCAATAACATATCATATATATATAACTATCGGCCTTAACAATCATACATATACAACTTTGTCACATCAGTTTA
TATTACTAGTGTTACTGTTACATCATTGCAAATATTGTAGAATACATTTCCAAATATTTATAGGTTACAAATGGTATGTGAACAGGCCGGGGGTCCAATATACGACATACCAAAAGGAAG
AAAGGATGGAAGGAGATCGAAAATAGAGGACACGATCAATCTACCCTTTCCCACCTTCAACGCATCAGAGCTCATTAGAGCCTTTGGCCAGCGTGGCTTCACTGCTCAAGAAATGGTTGC
TTTATCAG
GTAATTGTCATTAACACGTCAATTGATAAAAAAATAGTTTCACTAAATGACACCAATATGACAATGATTCGATGAATTTGAATGAATGATTTAGCAGTACTGCACCACTATA
TGTTTCGTGTTATTCGATTTGATAATAAATCTCAACCCGTACTGCATATAGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNGTATAACTAATAACGTTAAACAAGTAATCGATACATATTA
TTATTTTTTTCTTTTTTTTCAAAAAGAGAATTTGTGGGATGTCCGAAATAGAAATGGCAACCACCCACCAAATGAAATACGACCTAAAATTCTCAACAATGAAATTCACATTCAATTTGA
GTTAACAAATAAGGGAAGTTAATTGTCTAACTCGTGTGTGTAACACTAGTAGACTTGATGGTGAGGCAGGGGCGCACACGATAGGGGTGGCCAGATGTTCATCATTCAAAAGTCGGTTGA
CCGGCGTTGACCCAACCTTGGATTCCGACTTCGCAAAGACGTTATCAAAGACTTGCAGCGCCGGGGACAACGCGGAGCAACCCTTCGACGCCACCAGAAACGATTTCGACAATCTCTACT
TCAATGCACTGATCAGAAAAGCGGGGGTTCTGTTTTCGGACCAAACACTGTTGACGAATGCGAAAACCAGAGCAGCTGTCAACGGTTATGCCATGAACCAGGCTATGTTTTTCTTGGACT
TCCAGCAGGCCATGGTGAAGATGGGCATGGTTGATGTGAAGGAAGGCGGCAAAGGAGAAGTTAGACACAATTGTCGCAAAATAAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAAGTTGCTTAGTGTTTTTTTGTTCATGGAAGTGATAGCAAGTGGTTTTAGGTTCGGAGTTGATGGACTTCGAATGGATTACTACATCATGACTTGCCCATTTGGTGAACAAATT
GTGACAAATGCTGTCGACAGGGCTCTCGACGATGATCCCACTCTTGCTGCTGCCCTTGTTAGAATGCATTTCCATGACTGTTTCATTGAG
GGGTGTGACGGGTCAGTTCTGATTGACTCA
ACGCAGGACAACAAAGCAGAAAAGGACTCTCCCGGCAATTTGAGCCTGCGGGGCTATGAAGTTATAGATGATGCTAAAAATCAGCTTGAAGAGCATTGTCCAGGCGTCGTTTCATGTGCC
GATATCATTGCTATGGCTGCTAGAGATGCTATTTTTTGG
GCCGGGGGTCCAATATACGACATACCAAAAGGAAGAAAGGATGGAAGGAGATCGAAAATAGAGGACACGATCAATCTACCC
TTTCCCACCTTCAACGCATCAGAGCTCATTAGAGCCTTTGGCCAGCGTGGCTTCACTGCTCAAGAAATGGTTGCTTTATCAG
GGGCGCACACGATAGGGGTGGCCAGATGTTCATCATTC
AAAAGTCGGTTGACCGGCGTTGACCCAACCTTGGATTCCGACTTCGCAAAGACGTTATCAAAGACTTGCAGCGCCGGGGACAACGCGGAGCAACCCTTCGACGCCACCAGAAACGATTTC
GACAATCTCTACTTCAATGCACTGATCAGAAAAGCGGGGGTTCTGTTTTCGGACCAAACACTGTTGACGAATGCGAAAACCAGAGCAGCTGTCAACGGTTATGCCATGAACCAGGCTATG
TTTTTCTTGGACTTCCAGCAGGCCATGGTGAAGATGGGCATGGTTGATGTGAAGGAAGGCGGCAAAGGAGAAGTTAGACACAATTGTCGCAAAATAAATTGA

Retrieve as FASTA