Entry information : CclPrx10 (clementine0.9_010034m)
Entry ID 8660
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2015-04-15 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2015-04-15 (Christophe Dunand)
Peroxidase information: CclPrx10 (clementine0.9_010034m)
Name (synonym) CclPrx10 (clementine0.9_010034m)
Class Class III peroxidase     [Orthogroup: Prx026]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx10
start..stop
S start..stop
CsPrx01 572 0 1..287 1..287
CsPrx02 382 2e-133 9..284 16..290
CclPrx09 380 2e-131 9..280 16..286
PtPrx19 258 1e-85 74..285 15..229
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 101927..102286 360 N° 2 101422..101610 189 N° 3 101156..101321 166 N° 4 100716..100894 179
complement(join(100716..100894,101156..101321,101422..101610,101927..102286))


exon

Literature and cross-references CclPrx10 (clementine0.9_010034m)
DNA ref. Phytozome 12:   scaffold_147 (102097..100716)
EST ref. GenBank:   FC881828.1 [5' end]
Protein sequence: CclPrx10 (clementine0.9_010034m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   297
PWM (Da):   %s   32844.54  
PI (pH):   %s   5.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRIVISFPISFENRNADTKKALNINSTSNFLHYVCYEYPASDPSLFRIAAGAGALFLSNGGKIEEGDCGEPYDSLQYDFNRDWCLQAEGRIRAMVWYLRKSRSGVAPAFLRLVFRDCSIEGCDSSVLLDEADGVDSEKMSLPSESLNRFYVINIIKEDLEEIFPGVVSYSDTLALAAREGVVLAGGPFYPLHTGRRDSRLALADIATFELPLPNADLPETLASFASRGFDLRETVTFLDAHGIGVIHCIFFKSHLCNFGRINESLDPGFLNLLRSKCRNVHSGSAVLVNCRLRTQIL

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Start M and long 3' end are missing). 5'end completed with ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGAATAGTGATCAGCTTCCCGATCTCTTTCGAGAACCGAAACGCCGATACCAAGAAAGCCTTGAACATCAACTCCACCAGTAATTTCTTGCATTATGTTTGTTACGAGTATCCAGCG
TCGGATCCTTCTCTCTTTCGGATAGCCGCCGGCGCTGGGGCCCTGTTCTTGTCCAATGGCGGGAAAATTGAAGAAGGCGACTGTGGCGAGCCTTATGATTCTTTGCAGTACGATTTCAAC
CGCGATTGGTGCCTACAAGCTGAGGGCCGTATTCGGGCCATGGTTTGGTATCTCCGAAAATCACGCTCCGGTGTAGCTCCTGCTTTCTTGCGCCTCGTTTTCCGGGATTGCTCCATTGAG
GTCCATTTTTATTCAGTCAACTTCAGTCAAATATTATTTTGTGTGTGTGTGGGTGTGTTTTTTTTTTTTAATATTCTGAGTTTTGTTAAATCTTGAATTTCTTTTTACTTCTTGCTATTT
CTAGTTATTTCATCCACTGATATACTCTCCAAACAATCTTGTTTATTCCGCTAATTTTTCACTAGGGTTATCTGATTTATTCACATTTTGATCTGGGTTAAGCAATTATTTTATGTGTAA
TTTTGTTAATTGGGTTCTTGCTATTTCAATCAGATTAATTTTGAGTTGAGTTTTCTGTAATTTGGAACTTGTTTAGGGTTGTGATTCTTCAGTTCTACTGGATGAAGCTGATGGAGTAGA
CTCAGAGAAAATGTCTCTTCCCAGTGAATCTCTCAATCGTTTCTATGTAATCAATATAATCAAAGAGGATCTCGAAGAAATTTTCCCTGGTGTGGTTTCTTATTCGGATACTCTTGCTTT
GGCTGCCAGAGAAGGTGTTGTTCTG
GTAAATTCCTGTATCATGTGACCATCCAAGTCTATGAAATCTGGCTTTCTATCTATGTTTGTACATTCTGTATAGATAATCATTGTGTCTTTGAA
TTTAGGCTGGTGGTCCATTCTATCCACTGCATACTGGCAGGAGAGACAGCAGGCTTGCTCTTGCAGATATAGCAACATTTGAGCTTCCTTTACCCAATGCTGATCTGCCTGAAACCCTTG
CATCTTTTGCATCAAGGGGGTTTGATTTAAGAGAAACTGTTACATTTTTGG
GTAGAGAGAAATCCTTATTTCATTTCACGTTCCTTTTTATTTTCATGGAAAAGAGAAATTTCTGATTTT
GGTTTGTATTTAATTGCTGCTGCAACTTTTTGCAATTTCCCCGTTCCAGCTGATTGTCTGATAGTTTAGTTCTGATCTCTTTGGTTCAAAATTTGATACTTGAGCTTAGGAGATTTCTTA
AGATTTCTAACTTTGTTATGGTTCAGTTTTGTGATAATAACAAGTACTGTTAGTCTGTGATTTTGTTCCCAGATGCTCATGGCATTGGAGTCATCCACTGCATATTCTTCAAGAGTCATC
TCTGTAACTTTGGGAGGATTAATGAATCTCTGGATCCCGGTTTTTTGAATCTGTTGAGATCAAAATGCAGAAACGTGCATTCAGGGAGTGCTGTTCTGGTAAATTGCAGACTACGTACCC
AAATTTTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGAATAGTGATCAGCTTCCCGATCTCTTTCGAGAACCGAAACGCCGATACCAAGAAAGCCTTGAACATCAACTCCACCAGTAATTTCTTGCATTATGTTTGTTACGAGTATCCAGCG
TCGGATCCTTCTCTCTTTCGGATAGCCGCCGGCGCTGGGGCCCTGTTCTTGTCCAATGGCGGGAAAATTGAAGAAGGCGACTGTGGCGAGCCTTATGATTCTTTGCAGTACGATTTCAAC
CGCGATTGGTGCCTACAAGCTGAGGGCCGTATTCGGGCCATGGTTTGGTATCTCCGAAAATCACGCTCCGGTGTAGCTCCTGCTTTCTTGCGCCTCGTTTTCCGGGATTGCTCCATTGAG
GGTTGTGATTCTTCAGTTCTACTGGATGAAGCTGATGGAGTAGACTCAGAGAAAATGTCTCTTCCCAGTGAATCTCTCAATCGTTTCTATGTAATCAATATAATCAAAGAGGATCTCGAA
GAAATTTTCCCTGGTGTGGTTTCTTATTCGGATACTCTTGCTTTGGCTGCCAGAGAAGGTGTTGTTCTG
GCTGGTGGTCCATTCTATCCACTGCATACTGGCAGGAGAGACAGCAGGCTT
GCTCTTGCAGATATAGCAACATTTGAGCTTCCTTTACCCAATGCTGATCTGCCTGAAACCCTTGCATCTTTTGCATCAAGGGGGTTTGATTTAAGAGAAACTGTTACATTTTTGG
ATGCT
CATGGCATTGGAGTCATCCACTGCATATTCTTCAAGAGTCATCTCTGTAACTTTGGGAGGATTAATGAATCTCTGGATCCCGGTTTTTTGAATCTGTTGAGATCAAAATGCAGAAACGTG
CATTCAGGGAGTGCTGTTCTGGTAAATTGCAGACTACGTACCCAAATTTTATAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTTCAGGAA AAAAAAAATT CTGAAACCCC ACACCAAAAA GCTCACAAAC AGAAATCTCC CCCAAAAAGC AAACAAAACA AGAAAAAGAA ATGCCGTATC AATCTTGGAA CTAGCAACAA  TGCGAATAGT GATCAGCTTC CCGATCTCTT TCGAGAACCG AAACGCCGAT ACCAAGAAAG CCTTGAACAT CAACTCCACC AGTAATTTCT TGCATTATGT TTGTTACGAG TATCCAGCGT  CGGATCCTTC TCTCTTTCGG ATAGCCGCCG GCGCTGGGGC CCTGTTCTTG TCCAATGGCG GGAAAATTGA AGAAGGCGAC TGTGGCGAGC CTTATGATTC TTTGCAGTAC GATTTCAACC  GCGATTGGTG CCTACAAGCT GAGGGCCGTA TTCGGGCCAT GGTTTGGTAT CTCCGAAAAT CACGCTCCGG TGTAGCTCCT GCTTTCTTGC GCCTCGTTTT CCGGGATTGC TCCATTGAGG  GTTGTGATTC TTCAGTTCTA CTGGATGAAG CTGATGGAGT AGACTCAGAG AAAATGTCTC TTCCCAGTGA ATCTCTCAAT CGTTTCTATG TAATCAATAT AATCAAAGAG GATCTCGAAG  AAATTTTCCC TGGTGTGGTT TCTTATTCGG ATACTCTTGC TTTGGCTGCC AGAGAAGGTG TTGTTCTGGC TGGTGGTCCA TTCTATCCAC TGCATACTGG CAGGAGAGAC AGCAGGCTTG  CTCTTGCAGA TATAGCAACA TTTGAGCTTC CTTTACCCAA TGCTGATCTG CCTGAAACCC TTGCATCTTT TGCATCAAGG GGGTTTGATT TAAGAGAAAC TGTTACATTT TTGGATGCTC  ATGGCATTGG AGTCATCCAC TGCATATTCT TCAAGAGTCA TCTCTGTAAC TTTGGGAGGA TTAATGAATC TCTGGATCCC GGTTTTTTGA ATCTGTTGAG ATCAAAATGC AGAAACGTGC 
ATTCAGGGAG TGCTGTTCTG GTAAATTGCA GACTACGTAC CCAAATTTTA TAA 

Retrieve as FASTA