Entry information : CclPrx102 (clementine0.9_031431m)
Entry ID 8663
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx102 (clementine0.9_031431m)
Name (synonym) CclPrx102 (clementine0.9_031431m)
Class Class III peroxidase    [Orthogroup: Prx105]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx102
start..stop
S start..stop
CclPrx87 650 0 1..319 1..319
PtPrx39 462 1e-165 1..319 1..319
PpePrx54 456 4e-163 1..319 1..322
PpePrx43 452 1e-161 1..319 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 614148..614357 210 N° 2 614543..614737 195 N° 3 615365..615919 555  
join(614148..614357,614543..614737,615365..615919)


exon

Literature and cross-references CclPrx102 (clementine0.9_031431m)
DNA ref. Phytozome 12:   scaffold_81 (614148..615919)
Protein sequence: CclPrx102 (clementine0.9_031431m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (296)
PWM (Da):   %s   34500.27 (32125.9) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.66 (7.29) Peptide Signal:   %s   cut: 24 range:24-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAIKSFVVYFVLAAAAIIPINAQLTPNFYEKMCPQALPTIRTVVRNAITNETRMGASLLRLHFHDCFVNGCDGSLLLDDTANFVGEKTAIPNNNSVRGFDVIDEIKQAVNTACKGNVVSCADIVAVAARDSVNLLGGPCYPVQLGRRDARTASFNDANANLPSPFSNFSVLLSSFQSQGLNLQDLVALSGGHSIGLARCPSFRNRIYNDSDIDPVFAASKQKNCPVTGGTFNTEPLDATTTLFDNQYFKDLIASRGLLHSDQQLFKNDSSDSDRLVRKYSTNPISFASDFSASMIKMGNLNVLTGNNGEIRMNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTATTAAATCTTTTGTTGTGTATTTTGTGTTAGCTGCTGCTGCTATCATCCCAATAAATGCACAGCTGACTCCTAATTTTTATGAAAAAATGTGTCCTCAGGCATTGCCAACT
ATAAGAACAGTTGTTCGAAATGCCATAACAAATGAGACTCGCATGGGAGCATCATTACTTCGTCTACACTTCCATGACTGCTTTGTCAAT
GTAAGTGTACTTTAGATTTTAGGCCCTCAG
GGTTAATCGAGTCAATCAGTTTTTTTTAGCTGGTTAGTAGAGTTCGAACCCCGAAAGAGTTAGGAGGTTAAAAAACATTTATAACTATGGTTAATAATTAATTGATATTTGTAATTATGA
TTATAGCTGTAATTATGTTTGTGTTTTTTGGATAGGGTTGTGATGGATCACTGCTTTTAGACGACACAGCCAACTTCGTTGGAGAGAAGACGGCCATACCCAATAATAATTCCGTCAGGG
GATTTGATGTGATTGATGAAATAAAACAAGCAGTTAATACAGCTTGCAAAGGCAACGTGGTCTCATGTGCAGATATTGTAGCCGTTGCAGCTCGTGATTCAGTTAATCTT
GTGAGTACAC
ACTTATCTCATTTTTGTATCGGTGGATGATCATATAGAATCCTAAGGAGTATTTATCTCTATGTCTGAAACTATTGTTTATTTTGTCGACCATCTGAGTTTTGAATCTTAAGAGATGTAC
GTAAAATTTTGATTTAAGCTTTGCCAATCCATCGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACTTAAAACAACTGAGTTTGTGCTTATTAATGGCAAACTTTCCTTTAGT
CTCTAGGGTTCAGTTTACTTACAAAGTTAATCTCTATCTTTTAAAACCCAAAACGTCCTTGCTATTGCTTTTATAGACGATGGACACCCAACTTTTCTAAGGNNNNNNNNNNNNNNNNNN
NNNNNNNNNCAAATAACAAGTAAAAAGGAAAAATACTTAAATTTTAACGGAAACTTGCCTATGATAAAGATGTTTTGGATAATTATATTAAAATGCAATTAATTTGCTTTAAAGGTACGG
TAGCTCAAGTTTACTAAACATCTGTTTGTCAAGCATCTACTAACTTATACTTGACAGTTAATAGTTCTATTACACAAATATCTTCAGGGCTTAATCCCAAATATATGAGACGAGTATATT
GCTTTTTGTGATTTCAGTTAGGAGGTCCATGTTATCCAGTACAATTAGGAAGAAGAGATGCAAGAACTGCAAGCTTCAATGATGCAAATGCCAATCTACCTTCCCCATTTTCAAACTTCT
CTGTGCTTCTTTCAAGCTTCCAATCACAAGGCTTAAATCTCCAAGACCTAGTTGCTCTCTCAGGAGGCCACAGCATTGGACTTGCTCGCTGCCCATCATTTCGGAACAGGATTTACAATG
ACTCAGATATAGATCCAGTATTTGCTGCTTCCAAGCAAAAGAATTGCCCAGTAACCGGAGGAACATTCAACACAGAACCACTTGATGCAACAACTACACTATTTGATAATCAGTACTTTA
AGGATTTGATAGCATCAAGGGGTCTCCTTCATTCTGATCAGCAACTTTTTAAAAATGATAGCAGTGATAGTGATCGGCTGGTGCGAAAGTACAGTACAAATCCAATTTCTTTTGCATCAG
ATTTTAGTGCTTCCATGATCAAGATGGGTAACTTGAACGTACTTACTGGTAATAATGGAGAAATCAGGATGAATTGCCGAAGAGTTAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTATTAAATCTTTTGTTGTGTATTTTGTGTTAGCTGCTGCTGCTATCATCCCAATAAATGCACAGCTGACTCCTAATTTTTATGAAAAAATGTGTCCTCAGGCATTGCCAACT
ATAAGAACAGTTGTTCGAAATGCCATAACAAATGAGACTCGCATGGGAGCATCATTACTTCGTCTACACTTCCATGACTGCTTTGTCAAT
GGTTGTGATGGATCACTGCTTTTAGACGAC
ACAGCCAACTTCGTTGGAGAGAAGACGGCCATACCCAATAATAATTCCGTCAGGGGATTTGATGTGATTGATGAAATAAAACAAGCAGTTAATACAGCTTGCAAAGGCAACGTGGTCTCA
TGTGCAGATATTGTAGCCGTTGCAGCTCGTGATTCAGTTAATCTT
TTAGGAGGTCCATGTTATCCAGTACAATTAGGAAGAAGAGATGCAAGAACTGCAAGCTTCAATGATGCAAATGCC
AATCTACCTTCCCCATTTTCAAACTTCTCTGTGCTTCTTTCAAGCTTCCAATCACAAGGCTTAAATCTCCAAGACCTAGTTGCTCTCTCAGGAGGCCACAGCATTGGACTTGCTCGCTGC
CCATCATTTCGGAACAGGATTTACAATGACTCAGATATAGATCCAGTATTTGCTGCTTCCAAGCAAAAGAATTGCCCAGTAACCGGAGGAACATTCAACACAGAACCACTTGATGCAACA
ACTACACTATTTGATAATCAGTACTTTAAGGATTTGATAGCATCAAGGGGTCTCCTTCATTCTGATCAGCAACTTTTTAAAAATGATAGCAGTGATAGTGATCGGCTGGTGCGAAAGTAC
AGTACAAATCCAATTTCTTTTGCATCAGATTTTAGTGCTTCCATGATCAAGATGGGTAACTTGAACGTACTTACTGGTAATAATGGAGAAATCAGGATGAATTGCCGAAGAGTTAACTAG

Retrieve as FASTA