Entry information : CclPrx104 (clementine0.9_032148m)
Entry ID 8665
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx104 (clementine0.9_032148m)
Name (synonym) CclPrx104 (clementine0.9_032148m)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx104
start..stop
S start..stop
VvPrx31 516 0 1..328 1..327
VvPrx30 502 0 1..328 1..327
NnPrx21 486 5.88e-175 1..328 1..328
NnPrx14 481 1.19e-172 1..328 1..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8665' 'complement(join(1078693..1079099,1079195..1079357,1079466..1079654,1079975..1080202))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1079975..1080202 226 N° 2 1079466..1079654 187 N° 3 1079195..1079357 161 N° 4 1078693..1079099 405
complement(join(1078693..1079099,1079195..1079357,1079466..1079654,1079975..1080 202))


exon

Literature and cross-references CclPrx104 (clementine0.9_032148m)
DNA ref. Phytozome 12:   scaffold_79 (1080202..1078693)
Protein sequence: CclPrx104 (clementine0.9_032148m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (301)
PWM (Da):   %s   35896.46 (32834.7)  
PI (pH):   %s   9.05 (8.88) Peptide Signal:   %s   cut: 28 range:28-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATQKLASLFFLQQIIHVLFILHLANADHGLKLGFYQKTCPDAEA
ITRKITHQHISRAPTLAAPLLRMHFHDCFIR
GCDGSVLLNSTKNNQAEKDAFANLSLRGYQVIDAVKSALENKCPGVVSCADILALVTRDAVSMIKGPFWDVPTGRRDGRESVASETRDLPPPFGNITLLKQKFAAKGLSVKDLVVLSGAH
TIGTSHCSSFETRLYNFTGKGDTDPTLDPNYVVHLKRKCQPGDTTTLVKMDPGSFRTFDGDYYTLVAKRRGLFQSDAALLEDTETKSYVKLQANTYGSTFAKDFAESMVNMGKIGVLTGK
AGEIRKHCAFVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCCAAAAGCTTGCATCACTTTTCTTTCTTCAACAGATCATTCATGTTCTTTTTATCTTGCACCTCGCAAATGCGGACCATGGCCTAAAACTCGGGTTCTACCAGAAGACGTGC
CCAGATGCTGAGGCCATTACTAGAAAGATAACACATCAACACATTTCTCGAGCACCAACTCTTGCTGCTCCTTTATTAAGGATGCATTTTCATGATTGTTTCATTAGG
GTAAGTTAAGCG
CAAATCGATTTTCTAACTTTTTACCTCATCATGATTTAAATTTGAGTGACCAATTAAAAATATCTACTTAAAAACATGTCAGTCAAACCTACGTGAGGAAGTTGTTAATTGATTAAAAGG
CATCATAGAATCAAAATATTATGCAATTCATCATCAAAATTGTGAAAAAGACCAATTAATGCTTAATTTTTTTCTGTCTCATAATATGAATTGATTTTTTTTTAACATTTATATTATAGC
TCCCACGTACACGATATTAATTATTGTTACCTAATGTTTATAATTAGTTAGTACCTAATTGCTGGCAGGGGGATGTGATGGTTCCGTGCTTCTAAATTCTACCAAAAACAATCAAGCGGA
GAAAGATGCATTCGCCAACCTAAGCCTGAGAGGATACCAAGTCATTGATGCTGTAAAATCTGCACTAGAAAATAAGTGCCCTGGTGTTGTTTCTTGCGCTGACATATTAGCTTTGGTTAC
TAGAGACGCAGTCAGCATG
GTAAGTTGGTAACCAACTGTCCTCCATATATGTATACATATGTACTTCATCAAATTCAACATTGATATATACATGTATGGTTCATTAAAATCTATCATTTT
GTTTCAGATATAAAAGGACCATTTTGGGATGTTCCCACGGGACGAAGAGATGGAAGAGAGTCGGTTGCCTCAGAGACCAGAGACTTGCCACCTCCTTTTGGCAACATAACATTGCTAAAG
CAAAAGTTTGCAGCCAAGGGTTTAAGCGTTAAAGACCTTGTGGTTTTATCAG
GTAATCCGAAATTTGTAACGTATGCTTTTCTAGATAAAAGATTTGTCAAGAGACTCTAATTAGTTCAC
TTGAGCCTTTTTTTTTTTTTTTAATAGGGGGGCCCATACTATTGGGACGTCTCATTGCAGTTCATTTGAGACTCGTTTGTACAATTTCACTGGCAAAGGCGACACAGACCCCACGTTGGA
TCCCAACTATGTGGTGCATTTGAAGAGAAAATGCCAGCCAGGGGACACAACTACACTCGTTAAAATGGATCCTGGAAGCTTCAGGACATTTGATGGAGATTACTACACTCTTGTTGCTAA
AAGAAGAGGGCTCTTCCAATCTGATGCGGCTCTTCTTGAGGACACTGAAACAAAATCTTACGTCAAACTTCAGGCTAATACCTATGGATCTACATTTGCTAAAGATTTTGCTGAGTCTAT
GGTGAACATGGGCAAAATTGGAGTGCTCACGGGCAAGGCTGGTGAAATTAGGAAGCATTGTGCATTTGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACCCAAAAGCTTGCATCACTTTTCTTTCTTCAACAGATCATTCATGTTCTTTTTATCTTGCACCTCGCAAATGCGGACCATGGCCTAAAACTCGGGTTCTACCAGAAGACGTGC
CCAGATGCTGAGGCCATTACTAGAAAGATAACACATCAACACATTTCTCGAGCACCAACTCTTGCTGCTCCTTTATTAAGGATGCATTTTCATGATTGTTTCATTAGG
GGATGTGATGGT
TCCGTGCTTCTAAATTCTACCAAAAACAATCAAGCGGAGAAAGATGCATTCGCCAACCTAAGCCTGAGAGGATACCAAGTCATTGATGCTGTAAAATCTGCACTAGAAAATAAGTGCCCT
GGTGTTGTTTCTTGCGCTGACATATTAGCTTTGGTTACTAGAGACGCAGTCAGCATG
ATAAAAGGACCATTTTGGGATGTTCCCACGGGACGAAGAGATGGAAGAGAGTCGGTTGCCTCA
GAGACCAGAGACTTGCCACCTCCTTTTGGCAACATAACATTGCTAAAGCAAAAGTTTGCAGCCAAGGGTTTAAGCGTTAAAGACCTTGTGGTTTTATCAG
GGGCCCATACTATTGGGACG
TCTCATTGCAGTTCATTTGAGACTCGTTTGTACAATTTCACTGGCAAAGGCGACACAGACCCCACGTTGGATCCCAACTATGTGGTGCATTTGAAGAGAAAATGCCAGCCAGGGGACACA
ACTACACTCGTTAAAATGGATCCTGGAAGCTTCAGGACATTTGATGGAGATTACTACACTCTTGTTGCTAAAAGAAGAGGGCTCTTCCAATCTGATGCGGCTCTTCTTGAGGACACTGAA
ACAAAATCTTACGTCAAACTTCAGGCTAATACCTATGGATCTACATTTGCTAAAGATTTTGCTGAGTCTATGGTGAACATGGGCAAAATTGGAGTGCTCACGGGCAAGGCTGGTGAAATT
AGGAAGCATTGTGCATTTGTCAATTAA

Retrieve as FASTA