Entry information : CclPrx105 (clementine0.9_032184m)
Entry ID 8666
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx105 (clementine0.9_032184m)
Name (synonym) CclPrx105 (clementine0.9_032184m)
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx105
start..stop
S start..stop
CsPrx16 743 0 1..363 1..363
MtPrx100 431 2e-152 62..361 47..343
MePrx118 430 6e-152 12..362 7..346
GmPrx64 426 2e-150 62..361 45..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 942603..942938 336 N° 2 943034..943376 343 N° 3 943488..943900 413  
join(942603..942938,943034..943376,943488..943900)


exon

Literature and cross-references CclPrx105 (clementine0.9_032184m)
DNA ref. Phytozome 12:   scaffold_67 (942603..943900)
Protein sequence: CclPrx105 (clementine0.9_032184m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (338)
PWM (Da):   %s   40547.23 (37738.8) Transmb domain:   %s   i5-27o
PI (pH):   %s   5.05 (5.05) Peptide Signal:   %s   cut: 26 range:26-363
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNYSSSISFFFFIILLVQLISISSATYNEQDQNKKSPLDVDLPVGDIGLDDSFASSEILQSDEWPSSSYYHRRCPNKNVEKIINKKVKEWVDKDYKIAPSLLRLHYHDCAVRGCDGSILLNNEGSERRANVSKTLRGFEMIDDIKAELEKECPETVSCADILAAAARDATVLLGGEYWDVPFGRKDGRVSIGKEADIVPMGHDNVTTLLEFFQSMGLEVSDLVILSGAHTIGRTSCAQVQDRIYNYKGTGKPDPSINEKYLNFLQRRCRWASEDAELDAETPWKFDNMYYKNLQNGLGLLPTDQLLLSDKRTEPIAKALASMPSFLYGQIFGASMKKFGKVNVLSGDEGEIRTNCNFVNSHSY

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTACTCCTCTTCTATTTCTTTCTTCTTCTTCATCATTCTTCTTGTTCAGTTGATTTCAATCTCATCAGCAACCTACAATGAGCAAGATCAAAATAAAAAATCCCCGTTGGATGTT
GACCTCCCAGTTGGTGATATCGGTTTAGACGACAGTTTTGCATCGTCAGAGATCTTGCAATCCGACGAATGGCCATCCTCCTCTTACTATCATCGGAGGTGTCCAAATAAAAACGTTGAA
AAAATCATCAATAAAAAGGTTAAAGAATGGGTTGACAAGGATTACAAAATTGCTCCCAGCCTTCTAAGGTTGCACTACCACGACTGTGCCGTTAGG
GTAAGAAATAATATCTCTTTTTTT
CTTTTATTAAAACGTACGACTTTTTAAAACACATACTAAAAAACTATGCGTCATTTTAACTAATAATGCAGGGATGTGATGGTTCAATTCTTTTGAACAATGAGGGAAGCGAAAGAAGGG
CTAATGTAAGCAAAACACTGAGAGGGTTTGAGATGATTGATGATATCAAGGCGGAGCTGGAGAAGGAATGCCCGGAAACAGTCTCCTGTGCCGACATTCTGGCAGCGGCCGCCAGAGACG
CCACCGTCCTTCTCGGTGGTGAATACTGGGACGTTCCCTTTGGAAGGAAAGACGGGCGAGTGTCTATTGGCAAGGAAGCTGACATTGTGCCAATGGGTCACGACAATGTTACCACCCTGC
TCGAGTTTTTCCAATCTATGGGATTAGAAGTGTCCGATTTGGTTATTCTCTCAG
GTAATTCCAAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTAAGTTCACGAGAGTTCAGAAATT
ATGAATTTATTACTTAAGTGTTAATGTGTATATTTTTCTCTCCAGGGGCACATACAATCGGTAGGACATCATGTGCGCAAGTTCAGGACAGGATTTACAATTACAAAGGGACAGGGAAAC
CGGATCCCTCCATTAATGAAAAATACCTCAACTTCTTGCAAAGAAGATGCAGATGGGCATCAGAAGATGCTGAATTGGATGCTGAAACTCCCTGGAAATTTGACAACATGTACTATAAAA
ATCTTCAAAACGGCTTGGGGCTGCTACCAACAGATCAACTCTTGCTCTCTGATAAAAGGACTGAACCCATTGCTAAAGCGTTGGCTAGCATGCCATCCTTCCTCTACGGCCAAATATTCG
GGGCCTCCATGAAAAAATTTGGCAAAGTTAATGTTTTATCAGGAGATGAAGGAGAAATCCGCACCAATTGCAATTTTGTCAATTCTCATAGCTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATTACTCCTCTTCTATTTCTTTCTTCTTCTTCATCATTCTTCTTGTTCAGTTGATTTCAATCTCATCAGCAACCTACAATGAGCAAGATCAAAATAAAAAATCCCCGTTGGATGTT
GACCTCCCAGTTGGTGATATCGGTTTAGACGACAGTTTTGCATCGTCAGAGATCTTGCAATCCGACGAATGGCCATCCTCCTCTTACTATCATCGGAGGTGTCCAAATAAAAACGTTGAA
AAAATCATCAATAAAAAGGTTAAAGAATGGGTTGACAAGGATTACAAAATTGCTCCCAGCCTTCTAAGGTTGCACTACCACGACTGTGCCGTTAGG
GGATGTGATGGTTCAATTCTTTTG
AACAATGAGGGAAGCGAAAGAAGGGCTAATGTAAGCAAAACACTGAGAGGGTTTGAGATGATTGATGATATCAAGGCGGAGCTGGAGAAGGAATGCCCGGAAACAGTCTCCTGTGCCGAC
ATTCTGGCAGCGGCCGCCAGAGACGCCACCGTCCTTCTCGGTGGTGAATACTGGGACGTTCCCTTTGGAAGGAAAGACGGGCGAGTGTCTATTGGCAAGGAAGCTGACATTGTGCCAATG
GGTCACGACAATGTTACCACCCTGCTCGAGTTTTTCCAATCTATGGGATTAGAAGTGTCCGATTTGGTTATTCTCTCAG
GGGCACATACAATCGGTAGGACATCATGTGCGCAAGTTCAG
GACAGGATTTACAATTACAAAGGGACAGGGAAACCGGATCCCTCCATTAATGAAAAATACCTCAACTTCTTGCAAAGAAGATGCAGATGGGCATCAGAAGATGCTGAATTGGATGCTGAA
ACTCCCTGGAAATTTGACAACATGTACTATAAAAATCTTCAAAACGGCTTGGGGCTGCTACCAACAGATCAACTCTTGCTCTCTGATAAAAGGACTGAACCCATTGCTAAAGCGTTGGCT
AGCATGCCATCCTTCCTCTACGGCCAAATATTCGGGGCCTCCATGAAAAAATTTGGCAAAGTTAATGTTTTATCAGGAGATGAAGGAGAAATCCGCACCAATTGCAATTTTGTCAATTCT
CATAGCTATTAA

Retrieve as FASTA