Entry information : CclPrx106 (clementine0.9_032999m)
Entry ID 8667
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-05 (Qiang Li)
Peroxidase information: CclPrx106 (clementine0.9_032999m)
Name (synonym) CclPrx106 (clementine0.9_032999m)
Class Class III peroxidase     [Orthogroup: Prx037]*
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx106
start..stop
S start..stop
CsPrx[P]66 597 0 1..317 1..315
CclPrx48 337 5e-116 2..317 3..319
CsPrx07 337 5e-116 2..317 3..319
CppPrx06 336 5e-116 2..317 1..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2469660..2469913 254 N° 2 2469995..2470063 69 N° 3 2470095..2470160 66 N° 4 2470236..2470391 156
N° 5 2470465..2470860 396  
join(2469660..2469913,2469995..2470063,2470095..2470160,2470236..2470391,2470465 ..2470860)


exon

Literature and cross-references CclPrx106 (clementine0.9_032999m)
DNA ref. Phytozome 12:   scaffold_16 (2469660..2470860)
Protein sequence: CclPrx106 (clementine0.9_032999m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (297)
PWM (Da):   %s   33898.51 (32017.5)  
PI (pH):   %s   10.36 (10.49) Peptide Signal:   %s   cut: 19 range:19-315
Sequence 358
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSYYLVLLLLIAASASLPANCNLSKHHYRSSCPEALSIVQAGVKAAVKNETRTAASLLRLHFYDCFVNACNFKSLHTCSHLFVTQPASSVRNRSSYP*FKWRVQxRACPGVVSWADILAIATRDSVVDLGGPSWKVRLERRDSTTVSRTAANTSIRRPTSNLSALISNFMGSLIEAHGSSKSLFPMAGAHTIGLARCTTFREHIYNGWNIGISFTESLRQICPASGNGSALASIYLQPVLxxxIIYTTRIC*MKRVLHSGQELFNGNSANSLVKRYADDISVFVKDFPRATIKMGNISPLTGSAGQIRINCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. A stop in the protein maybe because of the bad sequencing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAACAAGTTACTACCTTGTCTTGCTTCTACTTATTGCTGCTAGTGCATCTCTTCCAGCCAACTGCAATCTCTCTAAGCACCACTACAGATCCTCATGCCCAGAAGCATTATCTATTG
TTCAGGCAGGAGTTAAAGCTGCTGTTAAAAATGAAACCCGAACTGCGGCATCTTTACTCAGACTGCATTTCTACGATTGCTTTGTTAACGCATGCAACTTCAAGTCTTTACATACATGCA
GCCATTTGTTTGT
GTTCGCTTTAGGTATTTTTAACTAAATATATTTGATTTTGATGATGATGACCAGGGCTGTGATGGATCGCTAATGTTGGATGACACAGCCAGCTTCATCAGTGAGAA
ACCGCAGTTCCTATCCATAATTCAAGTGGAGGGTTCAATGNCG
GTTGATGATATTAAAGCTAAAATGGAAAAAGAGCATGCCCAGGTGTGGTGTCCTGGGCAGATATTCTCGCAATTGCT
ACTCGCGACTCAGTTGTTGA
TGTGAGCGCCAAATATTCCCTAGATGAAAAGCTGGTTGTTTCACCCTCATATGCTTCAATTTCTTGGCAATTGCAGTTAGGGGGTCCTTCATGGAAAGTT
AGATTGGAAAGAAGAGATTCTACAACAGTAAGCAGGACAGCTGCAAACACTTCAATCCGTCGACCCACTTCTAATTTAAGTGCTCTCATATCAAACTTCATGGGGTCTCTCATTGAAGCA
CATGGTAGCTC
TTGCTGGTAATTCAGCATTATTCAACTAATTGACAAAAGGATATGAAGAATCAATCTGCCTCTACCATAATTAAAAAAGCTTATTTCCGATGGCAGGGGCACACACGAT
AGGCCTGGCAAGATGCACAACATTTCGAGAACACATTTACAATGGTTGGAATATTGGCATCTCCTTCACCGAATCATTGCGGCAAATATGCCCAGCAAGCGGAAATGGCAGTGCTCTAGC
AAGCATCTACCTTCAACCTGTTTTGNNNNNNNNNATAATTTATACTACAAGAATCTGTTGAATGAAAAGAGTCCTTCATTCAGGTCAAGAGTTATTTAATGGTAATTCTGCCAATTCTCT
GGTGAAAAGATATGCTGATGACATCTCAGTGTTTGTCAAGGACTTTCCCAGAGCCACGATCAAGATGGGCAACATCAGTCCTCTTACCGGAAGTGCTGGACAGATCAGGATCAATTGCAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCAACAAGTTACTACCTTGTCTTGCTTCTACTTATTGCTGCTAGTGCATCTCTTCCAGCCAACTGCAATCTCTCTAAGCACCACTACAGATCCTCATGCCCAGAAGCATTATCTATTG
TTCAGGCAGGAGTTAAAGCTGCTGTTAAAAATGAAACCCGAACTGCGGCATCTTTACTCAGACTGCATTTCTACGATTGCTTTGTTAACGCATGCAACTTCAAGTCTTTACATACATGCA
GCCATTTGTTTGT
GACACAGCCAGCTTCATCAGTGAGAAACCGCAGTTCCTATCCATAATTCAAGTGGAGGGTTCAATGNCGAGCATGCCCAGGTGTGGTGTCCTGGGCAGATATTCTCG
CAATTGCTACTCGCGACTCAGTTGTTGA
GTTAGGGGGTCCTTCATGGAAAGTTAGATTGGAAAGAAGAGATTCTACAACAGTAAGCAGGACAGCTGCAAACACTTCAATCCGTCGACCCA
CTTCTAATTTAAGTGCTCTCATATCAAACTTCATGGGGTCTCTCATTGAAGCACATGGTAGCTC
AAAAAGCTTATTTCCGATGGCAGGGGCACACACGATAGGCCTGGCAAGATGCACAA
CATTTCGAGAACACATTTACAATGGTTGGAATATTGGCATCTCCTTCACCGAATCATTGCGGCAAATATGCCCAGCAAGCGGAAATGGCAGTGCTCTAGCAAGCATCTACCTTCAACCTG
TTTTGNNNNNNNNNATAATTTATACTACAAGAATCTGTTGAATGAAAAGAGTCCTTCATTCAGGTCAAGAGTTATTTAATGGTAATTCTGCCAATTCTCTGGTGAAAAGATATGCTGATG
ACATCTCAGTGTTTGTCAAGGACTTTCCCAGAGCCACGATCAAGATGGGCAACATCAGTCCTCTTACCGGAAGTGCTGGACAGATCAGGATCAATTGCAG

Retrieve as FASTA