Entry information : CclPrx107 (clementine0.9_033157m)
Entry ID 8668
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CclPrx107 (clementine0.9_033157m)
Name (synonym) CclPrx107 (clementine0.9_033157m)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx107
start..stop
S start..stop
CsPrx58 651 0 1..328 1..328
PpePrx78 487 3e-175 6..326 8..324
PpePrx73 486 6e-175 6..326 8..324
PkPrx01 441 4e-157 6..326 5..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 966886..967092 207 N° 2 966417..966611 195 N° 3 965886..966051 166 N° 4 965282..965700 419
complement(join(965282..965700,965886..966051,966417..966611,966886..967092))


exon

Literature and cross-references CclPrx107 (clementine0.9_033157m)
DNA ref. Phytozome 12:   scaffold_31 (967092..965282)
Protein sequence: CclPrx107 (clementine0.9_033157m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (306)
PWM (Da):   %s   35293.39 (32719.1)  
PI (pH):   %s   4.72 (4.54) Peptide Signal:   %s   cut: 23 range:23-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRFRVTTIFLFVALMFGASNAQLSSTFYATTCPNVSSIVRGVVEQARNNDARIGARLIRVHFHDCFVNGCDGSLLLDDSAPDGIQSEKNGNPNLSTGGYEVVDDIKTALENVCPGVVSCADILAIASQILVSLDGGPTWQVQLGRRDSRTANLAGTSGIPLGNETLDRISEKFRAVGLDDPTDLVALSGAHTFGRARCVAFRNRLFNFDGAGNPDPTIDPTYLQTLRQNCPQGGNGNALVDLDPTTADGFDNNYFTNLQNNRGLLTSDQVLFSTTGAETVAIVNRFANSQTDFFDTFGQAMINMGNIRPLTGNNGEIRSDCRRINSN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCGGTTTCGAGTTACAACTATTTTTCTCTTTGTTGCTTTAATGTTTGGAGCATCTAATGCCCAATTGAGCTCAACATTTTATGCGACCACATGCCCTAATGTGTCAAGCATTGTA
CGCGGTGTTGTAGAGCAAGCTCGAAACAATGATGCCCGAATTGGCGCCAGACTCATTCGTGTCCACTTCCATGATTGCTTTGTTAAT
GTAATTGCTTTGCCCATTGTGGCTTGCCGAACN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATAAAGTGTGTGTCCAAATTATTTTTTTAATTACTATCTTTCCTAGAGTTTGAACTCATGTGAATGATCAGCCAA
ATAAAGCGATTGAAAACCATTCGACAAAGCCCCTTCATTAAAAAGCTAACTCATGTCATATTATCATTTAGTAAATACTAATGAATATATATATTTTTAATCTATTTTTCTCTATATACA
GGGCTGTGATGGGTCGCTTTTGCTTGATGATTCAGCCCCCGATGGCATACAGAGCGAGAAAAATGGAAACCCCAACCTATCAACCGGCGGGTATGAAGTAGTTGATGACATCAAAACTGC
ACTGGAGAACGTTTGCCCCGGTGTCGTCTCCTGTGCTGACATCTTGGCCATTGCATCTCAAATCTTGGTTTCTTTG
GTAATTTCATTACCTAGTTTCCTATATACGTTTCTTCTACTATC
TTAATTAGTAAGAGTCGTTCTCTAGTTCAGACATTTGCAAGCAGAATTACCCATGACACTTATTTCTATAATTTAGCACGCAATATAGTTATTTATTTTTTTACCTTTTGCATCGTGGAA
ACTAGATATTTCCTTCCCATTTTAATGAGTGTGTATAAGAGATTTTATTTATTGAACCAATAAGCACTTATAATATAATTCTGTCTTTCTATCTGAATCTGTTAAAACTTAAATAGTAGA
AAAAATTGTCATGCTATTATTTTATACAGATTTATTTTTCTTGTACATCAATAAAATCATTAAGAAATGGACATTTTACAGGACGGAGGTCCGACGTGGCAAGTGCAGCTAGGAAGGAGA
GATAGCAGGACTGCAAATCTAGCTGGGACTTCAGGCATTCCACTCGGCAATGAAACCCTGGATCGAATTTCTGAAAAGTTCAGAGCTGTAGGACTTGATGATCCCACTGACCTAGTTGCT
TTATCAG
GTATATTTGCTATTTAACATTGCTAAACTGATCTTTTTAGCCTTGAATTCAAACTCAGTAGCTAGCTAAAGAAAACTGTTTTAAAATCACTCGGCTGTGCATGTACTGGAGGC
TTATTTGTTATATCTTCTTCTCATGATATGTAGCATTTACATGGAACTAATATAAATTACCGTGTGTCCCAGGTGCACATACATTTGGACGTGCTCGGTGTGTAGCATTCAGGAACCGTC
TGTTCAATTTCGACGGTGCCGGAAACCCTGATCCGACCATAGATCCGACGTATCTTCAAACCCTTCGCCAAAATTGCCCGCAAGGCGGCAATGGCAATGCCTTAGTCGATCTTGATCCGA
CGACGGCTGATGGTTTTGACAATAACTATTTTACAAATCTTCAAAACAACCGAGGGCTTCTTACATCTGATCAAGTTTTGTTCTCTACAACTGGCGCTGAGACTGTTGCCATTGTCAACC
GCTTCGCTAATAGTCAAACGGACTTTTTTGATACTTTTGGGCAAGCAATGATCAATATGGGAAATATAAGGCCATTGACTGGGAATAATGGCGAGATTAGGTCCGATTGCAGGAGGATCA
ATTCAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCGGTTTCGAGTTACAACTATTTTTCTCTTTGTTGCTTTAATGTTTGGAGCATCTAATGCCCAATTGAGCTCAACATTTTATGCGACCACATGCCCTAATGTGTCAAGCATTGTA
CGCGGTGTTGTAGAGCAAGCTCGAAACAATGATGCCCGAATTGGCGCCAGACTCATTCGTGTCCACTTCCATGATTGCTTTGTTAAT
GGCTGTGATGGGTCGCTTTTGCTTGATGATTCA
GCCCCCGATGGCATACAGAGCGAGAAAAATGGAAACCCCAACCTATCAACCGGCGGGTATGAAGTAGTTGATGACATCAAAACTGCACTGGAGAACGTTTGCCCCGGTGTCGTCTCCTGT
GCTGACATCTTGGCCATTGCATCTCAAATCTTGGTTTCTTTG
GACGGAGGTCCGACGTGGCAAGTGCAGCTAGGAAGGAGAGATAGCAGGACTGCAAATCTAGCTGGGACTTCAGGCATT
CCACTCGGCAATGAAACCCTGGATCGAATTTCTGAAAAGTTCAGAGCTGTAGGACTTGATGATCCCACTGACCTAGTTGCTTTATCAG
GTGCACATACATTTGGACGTGCTCGGTGTGTA
GCATTCAGGAACCGTCTGTTCAATTTCGACGGTGCCGGAAACCCTGATCCGACCATAGATCCGACGTATCTTCAAACCCTTCGCCAAAATTGCCCGCAAGGCGGCAATGGCAATGCCTTA
GTCGATCTTGATCCGACGACGGCTGATGGTTTTGACAATAACTATTTTACAAATCTTCAAAACAACCGAGGGCTTCTTACATCTGATCAAGTTTTGTTCTCTACAACTGGCGCTGAGACT
GTTGCCATTGTCAACCGCTTCGCTAATAGTCAAACGGACTTTTTTGATACTTTTGGGCAAGCAATGATCAATATGGGAAATATAAGGCCATTGACTGGGAATAATGGCGAGATTAGGTCC
GATTGCAGGAGGATCAATTCAAATTAA

Retrieve as FASTA