Entry information : SbPrx71 (Sobic.004G105100.1 [2.1] / Sb04g008590 [1.4])
Entry ID 867
Creation 2008-10-21 (Christophe Dunand)
Last sequence changes 2011-01-24 (Toky Ramarohetra)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx71 (Sobic.004G105100.1 [2.1] / Sb04g008590 [1.4])
Name (synonym) SbPrx71 (Sobic.004G105100.1 [2.1] / Sb04g008590 [1.4])
Class Class III peroxidase    [Orthogroup: Prx131]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Callus
Seedlings
Inducer Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx71
start..stop
S start..stop
SofPrx08 576 0 1..325 1..324
ZmPrx37 533 0 1..325 1..321
SiPrx76 518 0 32..325 31..325
BdiPrx96 492 2e-177 30..325 27..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9992073..9992300 228 N° 2 9992489..9992680 192 N° 3 9993329..9993886 558  
join(9992073..9992300,9992489..9992680,9993329..9993886)


exon

Literature and cross-references SbPrx71 (Sobic.004G105100.1 [2.1] / Sb04g008590 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_4 (9992073..9993886)
Protein sequence: SbPrx71 (Sobic.004G105100.1 [2.1] / Sb04g008590 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (297)
PWM (Da):   %s   33424.75 (30802.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.93 (7.68) Peptide Signal:   %s   cut: 29 range:29-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPASLLLTRVAAATVAVACVVALGAMAQQLSPTFYDASCPNLQSIVRSGMAAAVQQEPRMGASILRLFFHDCFVQGCDASVLLDDSATLTGEKNAAPNANSLRGFEVIDAIKSQVEAACPGTVSCADILALAARDGVNLLSGPTWAVQLGRRDTRTASQSAANSNLPSPSSSAAALVSAFASKGLDSRDLVALSGAHTIGAARCASFRSRIYNDSNINAGFAAKRKQICGPQSGGTDGNLAPLDAMSSVKFDNGYFRDLVSQFGLLHSDQELFGAGVVDSVTARYARNGAAFSSDFVTAIVKMGNISPLTGSSGEIRANCRKPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 1 and 2) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCGGCGTCCTTGTTGTTGACGCGAGTGGCGGCGGCGACGGTGGCCGTGGCGTGCGTGGTGGCGCTCGGCGCCATGGCGCAGCAGCTGTCGCCGACGTTCTACGACGCGAGCTGC
CCCAACCTGCAGAGCATCGTGCGCTCCGGCATGGCCGCCGCCGTGCAGCAGGAGCCCCGGATGGGGGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GTAAAAAGCTAG
CTTAGCTTTTGCTTGCTAGTTGCCATATCCAACGTCGCCATCCAACTCCACGGTTAGTTGCGGCATTTCCGCATCTGATCGATGATGAAACCGCTGGACGGACGGAATGACACTGACATG
GACGTTGCCGGCCGGCATGGCATGGCATCATGGCATGGCTGGATCGTGCATTGCAGGGGTGCGACGCGTCCGTGCTCCTCGACGACTCGGCGACGCTGACGGGGGAGAAGAACGCGGCGC
CCAACGCCAACTCGCTGCGGGGCTTCGAGGTCATCGACGCCATCAAGTCCCAGGTGGAGGCCGCCTGCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCGCGCGACGGCG
TCAACCTG
GTCAGTCAGAGTCGTCGTTTGCCATTTCCCCTCTGCTTGTTGCCTGCATCATGTCATCGCACGGCCGTCCAAGCATGCTAGGGACACCACACCACCACCACCACCTGCCGAC
ACCCCGTACTGCTTGCTGCCACCCATGTCCATCATCAGTCAGTGAGTAAAAAATGCATCTTGGATTCTTGATGATCCATAGCCATTAGCACAATTAGCCATGCTCATGCATGCAACTCGA
TCGGCTCGATCGGTCCCGTCAAACTAGCTGCATGAGCAACGTGCGGGGCCAGCAACCTTCACCAACCGCTTACCCCGGGTCCATGGCTAGCACGACGGATGCTTCCTCATCTGATCGATC
TTCTTCGCCCTTTTTGTCGTCAAACGCTCAGTCTCACATGTGGCTACTGTACGTCGGTAGCTGCTCTGTTCATCCGTCACAGTAGCAAGTTTTACTTGCACTAGTTGCACTCCATGACAC
TCGACGAACACAATGTGGTGGTTGTCTTGCAAGTGGCCATACATAGCTGATAGCTTAATTAATCAACTACTATACTACACTTGGTTTAGTAGATTTGTTTGCACTGTAATGTTGGAGATC
GAGTAGTAGCATTTTCACTGACATGCATGACAAACAATGGAACAATGCAAATGCAGCTGAGCGGGCCGACATGGGCGGTGCAGCTAGGGCGGCGGGACACGCGGACGGCGAGCCAGTCGG
CGGCGAACAGCAACCTCCCGTCGCCATCCTCGAGCGCGGCGGCACTGGTGTCGGCGTTCGCGTCCAAGGGTCTGGACTCGCGGGACCTGGTGGCGCTCTCCGGCGCGCACACGATCGGGG
CGGCGCGGTGCGCGAGCTTCCGGTCGCGGATCTACAACGACAGCAACATCAACGCCGGGTTCGCGGCGAAGCGGAAGCAGATCTGCGGGCCGCAGTCGGGCGGCACCGACGGCAACCTGG
CGCCGCTGGACGCCATGAGCTCCGTCAAGTTCGACAACGGCTACTTCCGGGACCTCGTGTCCCAGTTCGGCCTCCTCCACTCCGACCAGGAGCTCTTCGGCGCCGGCGTCGTCGACTCCG
TCACGGCGAGGTACGCGCGCAACGGCGCCGCCTTCTCGTCGGACTTCGTCACCGCCATCGTCAAGATGGGTAACATCAGCCCGCTCACCGGCTCCTCCGGCGAGATCCGCGCCAACTGCC
GGAAACCCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCGGCGTCCTTGTTGTTGACGCGAGTGGCGGCGGCGACGGTGGCCGTGGCGTGCGTGGTGGCGCTCGGCGCCATGGCGCAGCAGCTGTCGCCGACGTTCTACGACGCGAGCTGC
CCCAACCTGCAGAGCATCGTGCGCTCCGGCATGGCCGCCGCCGTGCAGCAGGAGCCCCGGATGGGGGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GGGTGCGACGCG
TCCGTGCTCCTCGACGACTCGGCGACGCTGACGGGGGAGAAGAACGCGGCGCCCAACGCCAACTCGCTGCGGGGCTTCGAGGTCATCGACGCCATCAAGTCCCAGGTGGAGGCCGCCTGC
CCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCGCGCGACGGCGTCAACCTG
CTGAGCGGGCCGACATGGGCGGTGCAGCTAGGGCGGCGGGACACGCGGACGGCGAGCCAG
TCGGCGGCGAACAGCAACCTCCCGTCGCCATCCTCGAGCGCGGCGGCACTGGTGTCGGCGTTCGCGTCCAAGGGTCTGGACTCGCGGGACCTGGTGGCGCTCTCCGGCGCGCACACGATC
GGGGCGGCGCGGTGCGCGAGCTTCCGGTCGCGGATCTACAACGACAGCAACATCAACGCCGGGTTCGCGGCGAAGCGGAAGCAGATCTGCGGGCCGCAGTCGGGCGGCACCGACGGCAAC
CTGGCGCCGCTGGACGCCATGAGCTCCGTCAAGTTCGACAACGGCTACTTCCGGGACCTCGTGTCCCAGTTCGGCCTCCTCCACTCCGACCAGGAGCTCTTCGGCGCCGGCGTCGTCGAC
TCCGTCACGGCGAGGTACGCGCGCAACGGCGCCGCCTTCTCGTCGGACTTCGTCACCGCCATCGTCAAGATGGGTAACATCAGCCCGCTCACCGGCTCCTCCGGCGAGATCCGCGCCAAC
TGCCGGAAACCCAACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGGCGCCAT GCCATGCGTT CACGGACTGC AAGCTCGATC TGCCCCTGTT GCGTGTCGGT CCACGCATGC GTGTAACCAC CGCAATCGGC CACACTATAT AGAGCTCAGG GGAGCAGCAG  TGCTGGGACA CCGGACGGAC TCCATTATCC ACAGCAGCAG CTCAATCAAT CAGTCCGAGA GGCAGCCTAT TCTTGCCAAT CCCAGAGTCG AGCAATCTAG CTAGCATCAT CCATGGCGCC  GGCGTCCTTG TTGTTGACGC GAGTGGCGGC GGCGACGGTG GCCGTGGCGT GCGTGGTGGC GCTCGGCGCC ATGGCGCAGC AGCTGTCGCC GACGTTCTAC GACGCGAGCT GCCCCAACCT  GCAGAGCATC GTGCGCTCCG GCATGGCCGC CGCCGTGCAG CAGGAGCCCC GGATGGGGGC CTCCATCCTC CGCCTCTTCT TCCACGACTG CTTCGTCCAG GGGTGCGACG CGTCCGTGCT  CCTCGACGAC TCGGCGACGC TGACGGGGGA GAAGAACGCG GCGCCCAACG CCAACTCGCT GCGGGGCTTC GAGGTCATCG ACGCCATCAA GTCCCAGGTG GAGGCCGCCT GCCCCGGCAC  CGTCTCCTGC GCCGACATCC TCGCCCTCGC CGCGCGCGAC GGCGTCAACC TGCTGAGCGG GCCGACATGG GCGGTGCAGC TAGGGCGGCG GGACACGCGG ACGGCGAGCC AGTCGGCGGC  GAACAGCAAC CTCCCGTCGC CATCCTCGAG CGCGGCGGCA CTGGTGTCGG CGTTCGCGTC CAAGGGTCTG GACTCGCGGG ACCTGGTGGC GCTCTCCGGC GCGCACACGA TCGGGGCGGC  GCGGTGCGCG AGCTTCCGGT CGCGGATCTA CAACGACAGC AACATCAACG CCGGGTTCGC GGCGAAGCGG AAGCAGATCT GCGGGCCGCA GTCGGGCGGC ACCGACGGCA ACCTGGCGCC  GCTGGACGCC ATGAGCTCCG TCAAGTTCGA CAACGGCTAC TTCCGGGACC TCGTGTCCCA GTTCGGCCTC CTCCACTCCG ACCAGGAGCT CTTCGGCGCC GGCGTCGTCG ACTCCGTCAC  GGCGAGGTAC GCGCGCAACG GCGCCGCCTT CTCGTCGGAC TTCGTCACCG CCATCGTCAA GATGGGTAAC ATCAGCCCGC TCACCGGCTC CTCCGGCGAG ATCCGCGCCA ACTGCCGGAA  ACCCAACTAG ACCACCAGTC AGCCAGTCAG TTTTCGAGAT TCGTGCTGAG GGAGGGAGGG ACGGACGGTC TGGATCGGGC GACATGGCCA GCTAAGAGGA GAGTGGCTTT TTTGCGTGGA  AAGTGTGGAG TGCGTTGGAA GGGAGCGGCG GAGCGGAGAC GATGATGATG ATGATGATGA TTTCAGGGAT TTGGTGGGTG GAGCGCCGCT GTCAGGACGC AGGATAGGAT GGATGAGGGA  GGGAGGTGGG GCCCAGCGTG CCGTGACACA ACGATCACTG CATGGCCATT GCTGCTTTTC GTTAATTTTT ATTTTTTTTA TTTGGCCGCG CGCATTATTC TTTTCTCTTC TTTGTACCCC 
GATTTTAACC TGTAAGTTTG TACGTACGTA CATTGGTCGA TTCATGATTA TTTTTTTTCA GGGAGGCGAC GAATAATTAA GAACAGACGA CAT 

Retrieve as FASTA