Entry information : CclPrx109 (clementine0.9_033616m)
Entry ID 8670
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-03 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-01-03 (Qiang Li)
Peroxidase information: CclPrx109 (clementine0.9_033616m)
Name (synonym) CclPrx109 (clementine0.9_033616m)
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx109
start..stop
S start..stop
PpePrx68 455 2.02e-162 2..324 1..326
HaPrx42 450 1.41e-160 1..324 1..325
EguPrx62 442 6.46e-157 3..324 4..325
MePrx79 441 6.63e-157 1..323 2..323
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '8670' 'join(145598..145825,145919..146098,146342..146501,147174..147178,147213..147569)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 145598..145825 226 N° 2 145919..146098 178 N° 3 146342..146501 158 N° 4 147174..147178 3
N° 5 147213..147569 355  
join(145598..145825,145919..146098,146342..146501,147174..147178,147213..147569)


exon

Literature and cross-references CclPrx109 (clementine0.9_033616m)
DNA ref. Phytozome 12:   scaffold_73 (145598..147569)
Protein sequence: CclPrx109 (clementine0.9_033616m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (298)
PWM (Da):   %s   34557.69 (31903.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.98 (9.13) Peptide Signal:   %s   cut: 27 range:27-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMMSSSAALVLALGLILVNFTGHCHGALQVGFYRGKCRLLVDVESVVATVVKAKFIMDPTITPALLRMQFHDCFVNGCDASILLDGRASEKTAPPNLSVRGYDVIDAAKAALESICPGVV
SCADIIAMATRDAVSLSGGGRYNVETGRKDGFVSLATNVNLPGPDIPLAQSVATFAKKGLNATDMVYLLGGHTVGIAHCSFFQKHWKTKNTGKPDPNMDPSLLVSLRRICPMNSARDNAV
NLDQDPASSLRVDNSFFKQIMMRRGILQIDQDLATNSLTKATVAKIATGNDFNAKFGEAMVKMGRVQVLTGNQGEIRKSCRAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (A short sequence in the middle is missing which has been completed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATGTCGAGTTCAGCTGCATTAGTACTGGCCCTAGGGCTCATTCTTGTAAACTTTACAGGCCATTGCCATGGCGCACTTCAGGTGGGATTTTATAGAGGAAAGTGTCGCCTGCTT
GTAGATGTTGAGTCTGTTGTTGCTACTGTTGTCAAGGCAAAGTTCATCATGGACCCAACTATCACACCCGCTCTCCTTCGTATGCAATTCCACGACTGCTTTGTCAAT
ATGTAAGTCCTT
TAACTAATTTGATTAATTGCACTACAATTTGCTCTTTTATGAACAAGCTGAAAGGCACCTTATGTAATGTTATGATATCAAAGGGATGTGACGCGTCGATTCTACTGGACGGGCGCGCCT
CTGAGAAAACTGCACCTCCAAATTTAAGCGTGAGGGGTTATGATGTTATTGATGCTGCGAAGGCTGCATTGGAGAGTATCTGCCCTGGCGTCGTCTCTTGCGCCGATATCATTGCCATGG
CAACCAGAGATGCTGTTTCCTTG
TGGTAACAATAGTGTTTTAGTAGCAAGGAAAATGAATAACGGAACTTCAACTAGGATTTGGATTCAGTGCATGTTAATATCTGAGTTTTGTTGCTCA
CTACTAAGTTTTAATATTACTAATGTACTACTGGCACACAAAAAAAAAAAAATCAACTCATCTATTTAAGATCAGCACTAGATTCAAATTCGGAGTCAATGCAACTATGACACATGTTTC
TTTCTTATTTTTTTTCTGGTTGATGCAGAGTGGAGGAGGGCGATACAATGTAGAAACAGGAAGAAAGGATGGGTTTGTATCTCTAGCAACAAACGTAAATCTGCCAGGTCCGGATATTCC
ATTAGCTCAGTCCGTTGCAACATTTGCTAAGAAAGGACTCAATGCCACAGACATGGTCTATCTTCTTG
TGGTATATATACTCCGCATTTCCCTCCTCGATACATATTCATACATTATTTC
GACACTTGGTCTTGAATATCTCTCATTTTTTACCTTTTAAATTTCTAAAACTGTCTGTTTACATTTTCGACATGAAAAGTTGAAAACTACAACCAAAAAACAGGCTTTTTGAGTTCTATT
GTTGTAAAAAGGTTTTGTATGTTAAAATAAAAACACTAGAATGTAATGTATAATATAAAAAATGAGAAATATTTATATATTGTTATTGGTGTGGCTAGGACTTTCAGATATTTAATATAA
AAGACTAATTAATCGGGTGGAGGGACTCATTCTACTTATAAACCTAAGCAACTTTTCTTTATTAACAAATGTAGGATATAACTTGACAATACCCTCTTAGATGAAACCAAATGGACTACA
GTCATCATCCGACACACCTGTGTTATTCTATCACCACATTCCCAGACTACTAGAATTTGACTTTTATACCAATTTGTTGCAAAACTAGATTTAAGATCTCAGGTATCCAACCCTAAAAAA
TTAATCTATCCTATTTTTAAACCTAAGTAACCCTCTTTATTAACTAAAATGAGACATAACTCAACAAGTACCTAACTGTCATTCTCTGTTTCGATAATGTGACTAATAATGTGTTTTATT
TTCTTGATAAATATGTTTATAGGAGGGGGCATACTGTGGGGATAGCACATTGTTCTTTCTTCCAAAAACACTGGAAAACCTGACCCTAACATGGATCCATCACTACTCGTCTCCTTGAGA
CGAATCTGTCCGATGAATTCAGCACGTGATAATGCAGTTAATCTTGATCAGGATCCCGCAAGTTCATTGAGAGTTGACAACTCTTTCTTCAAGCAAATTATGATGCGTAGAGGCATTCTG
CAAATAGACCAAGATCTAGCAACGAATTCGCTTACCAAAGCCACAGTGGCTAAAATAGCGACTGGGAATGACTTTAATGCTAAATTTGGCGAGGCCATGGTCAAGATGGGACGAGTTCAA
GTTCTTACCGGCAATCAAGGGGAGATAAGGAAATCATGCCGGGCCGTCAATAAACGCTGA

Retrieve as FASTA