Entry information : CclPrx111 (clementine0.9_033870m)
Entry ID 8672
Creation 2011-06-25 (Qiang Li)
Last sequence changes 2012-01-04 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-05 (Qiang Li)
Peroxidase information: CclPrx111 (clementine0.9_033870m)
Name (synonym) CclPrx111 (clementine0.9_033870m)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus clementina    [TaxId: 85681 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CclPrx111
start..stop
S start..stop
CsPrx50 569 0 25..331 25..332
CclPrx31 567 0 25..331 25..332
CsPrx51 521 0 71..331 130..390
MguPrx86 456 5e-163 25..327 23..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1143183..1143401 219 N° 2 1126471..1126653 183 N° 3 1125807..1125969 163 N° 4 1125091..1125521 431
complement(join(1125091..1125521,1125807..1125969,1126471..1126653,1143183..1143 401))


exon

Literature and cross-references CclPrx111 (clementine0.9_033870m)
DNA ref. Phytozome 12:   scaffold_31 (1143401..1125091)
Protein sequence: CclPrx111 (clementine0.9_033870m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (305)
PWM (Da):   %s   35081.54 (32452.1)  
PI (pH):   %s   4.93 (4.91) Peptide Signal:   %s   cut: 27 range:27-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLRYLIAAALVVAFVLEGSSPAQAQLSPFFYSSTCPNVTNIIREVLQNAFLSDIRIGASLIRLHFHDCFVNGCDASVLLDGSDSEKFAAPNRNSARGFEVIDAIKTAVEDQCSGVVSCADILAIAARDSVLLSGGPTWKVLLGRRDGLVANQTGANALPSPFEGLNILTAKFAAVGLNIKDLVSLSGAHTIGFAKCAFFSNRLSNFSGTGAPDATMDTSLVSELQSLCANGDGNNTTPLDRNSIDLFDNHYFQNLINNKGLLSSDQILYSSDEAKSTTESLVESYSSNSNLFFANFVNSMIKMGNVSPLTGTNGEIRKNCRAVNSLTEI

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from phytozome (A big 5' end is missing which has been completed manually).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTTCGTTATCTTATTGCAGCTGCTCTTGTAGTTGCATTTGTGCTTGAGGGATCATCACCAGCCCAAGCTCAACTTTCTCCCTTTTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGGGAGGTGCTTCAGAATGCTTTCTTGTCCGATATTCGTATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTTGTTAAT
GTAATCAATCTCCACTCTTTG
ATTTTTCTTCTTCTTCAATTAATATTTTAAAACACGAGTTAAAGTCCTCTCCTAATATGAATTCTGCTTACTATTTTTTAAAAATCTTGTGTAACAAGTCTATTATTAGTAATATATGAT
TGAAATATAACCACGTACACTTATATCCTTACCTTCTAATAATCACAATTAAGCTCAGGAAAAGCTTACGTCATGAGGGGATCATGGTCTTCAAAACTTATATTACAATAAGGCAATTTG
TATATATGTATGTTTATTCAAAAAAGAAAATGCACAAGTTTGCATTATTTTTCTTAATCGTAAGATAAGAAGAATCTACCTAATTATTAAATTAACGATACAACAGCAGTTGATCACAAC
AAGTTTTTGATGTTATTTCAGGGCTGTGATGCATCGATTTTGCTGGACAATACTACTACCATAGACAGCGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTTGAAGTTGTT
GATGACATGAAAGCTGCCGTTGAAAGGGCCTGTCCAGGCGTTGTTTCCTGTGCTGATATTCTTACTATTGCAGCTGAAGAATCTGTTGCTCTGGTATGTGTGAATTTCTATTAACAACTC
CTCATCTTTCTCGACTACATATTTTATGCTTAAAAGTGATTAAATTACTATGGTATCAGAGTGTAAGTTTGACTTTACATTCGTGTTGGAATTTTCAGACCCTGAGTACTTTAACTAAAT
GAATCCACATGCTTAGTTTTGAGCGGCAACAGTCCCATCGAATTACCATGTTGACTTCGTGATAGCCCCGGGCCAAATTTTCCGTTTGAAAAGGGGAGGGTTTTTCTTTNNNNNNNNNNN
NNNNNNNNNNNNNNNAAAAAAAAAACACAAAAAAAAACGGTGATGCGATTCATCGAGGACACATCAGTTTTACGTGCTGGGTTCCAGTATATATTTTGAAAAAAAAAAAAAATTCTTCTT
TATATGATACAGTCTGGTTGAACCGTTCACTCAAAATTATAACGTCGGGAAACTGCTAATTTTGGGTGCAACAAGACCCATATAAATATTAGCCAAATAGAGTCGGAAAGATTAATTGCA
TGTGTCTTTCTAATTTTAGTTAAATTTGTTTATTATGCATCTCTCAAGTGATGCTTTTGACTAATGATCGTGGTTTTGGTAACAGTCAGGGGGTCCTGCATGGACAAATCTATTGGGAAG
AAGAGACAGCAGAACAGCAAACAGGACTCTTGCAAATGAAAATCTTCCAGGACCGAACAATAGTCTTGAGAGGCTCAAAGATAGATTCAGAAATGTTGGCCTCAACGACAATTTTGATCT
TGTTGCACTCTCCGGTAATATTTGCTTTTACGCCCTTTGACTTGAGTACAAACAGACCTTGGAGTCTTTTGGGATAAAGCAGTATTGGAGCCAGAATTAGAAATCTGGATGGTGGAAAAT
TTTTTAATGCCAATACTGAGTCTTGAAATCTTAGAGATAGTTTAAATGTTGAATATCTTATTTAAAAAGAAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNTTACTAAGACGACCACCGACACAAAGCACATTCATACTCTACAGCACCTAGGAGGCTTGACTGAATATCCTAATGATGCGAAGAAACTGTGTTTTAAAGTTT
GACATTGGTGATTAGGAATATGTTAAAACGTTTGACAAATTTACTCCCCTTAATCACATCATGAAATTTGAATTGCTTCCCAAAAAGAAAAGTGAGAACCACCATAATGAAACTCAGTTA
TTATCCTTAATTTGTATGAATTTGAGTAAAAATAACAAAGATCGGCTATGCATGTTTTTCAGGAGCTCACACGTTTGGAAGGGCTCAGTGCCGAACTTTTAGCGATAGATTATTCAATTT
CAACAACACTGGCAATCCAGACCCAACACTTAACACAACCCTCTTACAGCAACTTAGGCAACTATGCCCACAAGGTGGAAACGGCAGCGTTCTAACTAATCTTGATGTCACAACACCTGA
TTTGTTTGACAACAAATACTTCTTCAATCTTCAAATCAGCAAGGGCCTTCTGCAGAGTGATCAAGAGTTGTTTTCGACTCCCGGTGCCGATACCACTGCCATTGTCAATGTCTTTAGTAG
CAACCAGGCTGCTTTCTTTAAAAGCTTTGTGATTTCAATGATAAGAATGGGGAATTTGAAACCATTGACAGGCAATCAAGGGGAGATTAGATCGAACTGCAGGAGGGTCAACGGAAACAG
TAATATAGAAACCAGATCATCGTCAGAGGGTGATTTGATCAGCTCTTTCTAAATAAGCTAGTTTGCAGCACATGTGAGAGATAGAGTTTGTGGGTAACAAACTCGTGAATTTACTCCTAT
GTTTTGCCTGAAACATGCTTTTTATTTTCAATAAACTAAGGTTGTGTTTGTGTATTCACATCCTTGCTTTCTATGTATCAGAAATCCTTGTCATACAGTATGTGTGTATTTTTTTTCCTA
TGTCATCGGTACGCATTGTCATCTGAGTCACTTTCCAGTTTTTAGTGATCCATTTTATCCCCCAGCTTTAAAATATTAACCGGAAAAAAACCTTATTCTTACATATTTCTTTCTATTTCT
ACTTTTTGTCAAATATCCGTAGTTTGACAAAATAGTAGGGAAGAATCTTTTATTTTCAGAAATAATCATACATAGCTTTTTTTATGGGATAACAAAACTTATTTTTAGACAAATTTTAAA
AATCCATTTGACAATTTTTGGGGTCTGTGTGTACCAAAAAAGAGCCTATATAATTTCTAAAACCAATTGAATCTCCGTACTATTTCACTAAACCATTTCGCAAGGCAAACACTAACTTAC
AACTGCTGTAAGTTACAGCACTCACAAAAATATGCATGAACAGTAATAAATGGTGGGTCCCATGTAATTTTTGTGTGTGCTGTAACTTACAGCTGGCTGTAAGTTAGGGGCTCCCATTTC
GCAATTATTATGATCCTTTTTCCCCATAAAAGAAAACATTAGTAGCAACAGTTATCTTTTTCATGATCATTAATAAAATCATTTTTTACCCATTTCAAAAGTCATCCAGCCATTTCTTAA
TTATTTAACTCCCACTTGAGGTTTCAATTAATCAAGACCTCATTTGAAATTAAAGTAAGACCGATTTACCTTTTAAAAACAACATTAAATTATTTAGAAAATATTTACTGCTATTTTTAA
AACCTCATTTGAAATTAAACTTCGAGGTTGCTGCAAAGTTCTAATCCTAATCTGGTTTGTTTGGTTATAAATAAAGAGGCATTTCTCTTTGTTTTCCAAGTCCTAAGACTAATTATTCTC
TTAATAGAGAAGTAGTAACTCTTAGACAAAATGGCTTCACTTCGTTATCTTCTTGCAGCAGCTCTTGTTGTTGCTTTTGTGCTTGAGGGATCACCATCTCAAGCTCAACTTTCTCCCTCT
TTTTATTCTTCCACATGCCCTAATTTATTGAACATTATCGAGGATGTGCTTAAGAAAGCTTTCTCGTCCGATATCCGCATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTT
GTTGATGTAAGCAATCTCTGCTCTCTCATTTTTCATCTTCTTTACGTTATCAAGCTCTCTGTCTATTTACTTATTGATATAACATAGTTTCAAGTNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCGGGTTTGCGGGTACAAT
TGCCATCCCTAGTTTCAAGCATGTCAATGAACAGTATCTTTATAATTTTTTGTGTCATTAAACAAAATATAGAGTTTTCATTAAGAGTTTGAATATATCATTTTAATTTCAACAACTTCC
AAAACCATTTTCATATATCTTTTTTTTTTCTCTTTTTCTTTTCTCTTTACGACAAATTTTTCCTCTCTAATTCGATGTACCGAGGACCATGTAATTCTTTGNNNNNNNNNNNNNNNNNNN
NNGGGGTTTTCATGTACTAGAAATTTAAATCTAGCAAAGATTTGGTCCAAAACAGGAATTCAAATCCACCTCATGGCCTCATCCCTGCTCAGTGCTTTTAATGATCATGGGTCCAATATT
AATGGTGCATGGTTGAAAAAAAATCACACTTGTTTTATATTCTTCCAACCGAAAATTTTGAATCAACAGGAAATCCTAGTCTTAAAAACATATGTAATAATAAGACAATTTAAATAAGAA
GAGTTTGCATTATTTATTTAATTTTTTTGAATTCATGTCCATAAGATAAGAAGGAATCTATCTACTTGTTAAAATAACAATATAATGGACTGTTAACATAGCAAGTTGTTAACTAATACT
ATTTTTTCCGGGGTGTGATGCATCGATTTTGCTGGACAGCACTAAAAACATAGACAGCGAGAAATTTGCTGCGCCAAATAATAATTCGGCGAGGGGTTTCGAAGTTATTGATAACATGAA
AGCTGCCGTTGAAAAGGCATGTCCAAGGGTTGTTTCCTGCGCTGATATTCTTACTATTGCGGCTGAACGATCCGTTGCTTTGGTATGAATTTCTTTTACCAACTCCTCTTCCTTATTAAT
ATTTTATGCTTAGAAGTAAATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTTGTAATGTAATTATTTTTTAATCTCAACCAATANNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTTGTAATG
TAATTATTTTTTTAATTTCAACTAGTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGGAAATAAAAC
CGCACTTCGCGCAGTTTTGAAAAAAAATTTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATGGGTATCAAAATAAGTGAACAGAATAATGGTAAATCTTTGCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCGTAAGTTCAACTTTACCCTTAGAAGAATACATTAATTAAATAATTATTCACATAGACCAATGTGCAAG
ATCTGAGTCCACATGTTTAGCCTTTGATTTAAGTGAAGGGATTCATAGTTGGACCCATCATTATTAAATTGGGACGACGCAATGGACTCCATTATTTAAAAGGCCCGGCTACAGTGCAAC
TGTGATACCGTGCTACAGTTACATTCAGCCGTTGGATCCACTTAGATGAGTGGAGTCTATTAGAATTTAATGGCTGGATGCAACAGTAGCACGGTACCATATTTGCACCACAATTTTTCC
CTTATTTAAAAGGGGTGACTTATTGACTATGGTGCATCAGCTACACTGTGTGGTACCAAAATTGCTACACATATGTCAATATAGTGATTATTAAGGGATAAATTGTTACTGACAGTGAGA
CACTTTTTACTGCGCTGGTGCATCGTAGCAAGTCCTTAGTTTTAAACTTAAAAGTTTTCTTCTTTTGTTATACGACAAAGTTTTGATTCAACGGCTAGCAAATTAAATAGTCCGCCCCAA
ACGCACATCTCTTAAGATTATTGTTGATTTTGAGTGAATGGCTTTTGGTTACAGTCAGGGGGTCCGTCATGGGCAGTTCCATTGGGAAGAAGGGACAGCAGAACAGCAAACAGAGCTCTT
GCAAATCAGAAACTTCCAGGACCATCTGATACTCTTGATGTGCTCAAATCTAGTTTTAGAAATGTTGGCCGCAATGACAATTTTGATCTTGTTGCACTCTCCGGTAATTATTAATTGCTT
CTGCATCCTTTTAATTACTTGAGTAAAGTTATGGGAGTAGACTTTTAAAAGTCAAAAGAGCATGGTACTAGCAAACCACGCTCAAAAATTAATTTAAGAAATGAGTGTTATGCCTTAAAT
TTATGTATACTTAACTCAAAATTGGGCATGCATGTTTTTCAGGAGCTCACAGGTTTGGTAGGGCTCAGTGCCGATTTTTCAGGGGCAGATTATACGATTTCAACAACACTGGCAAGCCAG
ACCCGACACTGGACAGAACCCTGTTAAAGCAACTGAGGGAACTATGCCCACAAGGTGGAAACGGCGGCGTTCTTGCTAATTTTGATGTCAAAACACCTGATGTTTTCGACAACAAATACT
TCTCCAATCTTAGACTCCGCAAAGGCCTTCTGCAGAGTGATCAAGAGTTGTTTTCGACTCCTGGTGCCGATACCGCTGCCATTGTCGAGGACTTTGGGAGGAACCAGAATGCTTTCTTTA
AAAACTTTGTGACCTCAATGATAAGAATGGGCAATTTGAAACCACTGCAGGAAATCAAGGGGAGATTAGATTGAACTGCAGGAGGGTCAATGGAAACAGTAATATTGCAACAAGATCATC
ATCATCGGAGGGTGATTTGGTCAGCTCTTTCTAATAAGCTAGCTTGCGGCATATGCGAGAGAGTTTTTGTGCTTAACAAACTCGAATTTAATCTTCGCTTTGTTTGAAACATGTTATGTA
TTTTCAAATAAATTAACTACCAAACTTGAGTTTAATCTAATTTTCTTGTCTGAAACATGTTATGTATTTTCAAATAAATTAATTAAACTTGTGTTTTTGTGTTCACGTCCTGCTTCTATA
CGCATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGTTCTTTCAACATCATCAATGTCACGTTTTAACCAATAAAAATTATGCATATATGTGGCTTGTGCCGTAGGCTTGCTGCTAAAAATTAAT
ATTAGATCGGGCAGAAAAATTTATGAATTTAAATTTATTTGTCGAATGATACTCTTGTTCTCTTAAAAATTCTTTTATCTCTCTTATTATTATTTTTCGTTTCGTCCTTGAAATTTAATA
AAATCAGTTTTCTCTTGAACTTAATTACGCTACTTTTATCTTTTATAATCTAAGAGAACATAGATGAATTTATCTGTTAAGGAATTTACCTTACATCAGTTAATTAAAATAGTTACAATT
CTAAAATTAAATTTTTATATGAATTACAAAACAATCACTAGCTATAGGCATAATATGTAGAAGCCATAGGGAAAATGATATTTCGGTAAATAATAATTAAAATTCCGAAGGGTTTTGATT
TGTGGAATCCACACGCTAAAAGAATAATATTAATCAGAGGCCAAGGCCCCGCTACCGCCACCAAACAAAGGCACCATTTCATGAATTATTAACTTTAAGTGGCTTAGATTCAACCACTCG
TGGGTGAGGAGAGTTTTAGTTTCATTTCTGTAAAGACTAAAAATAAATAAATAAAACGGCTGGGAGGACCGGTACGGCTTCAAAATTTTGTGGTGAAACATACGCTTTTACTATATCTTA
GGGAAAACATTAATTATGTAATTATTTCATTATATCATTTTACGTTTTCTGTTTTGCATTTTACATTTTCGTTTTCACCGAAATAAAAAATGGGTTCATAATTTGCAGCCACCAAATAAG
TTCACATTTAAGACTAAACTATTAATTTTGAAAAAATAGATGTGCTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCCGCGATTTCAGATACAAGCTTGGCGTTCATCAAATGT
CACTTGCCAGCTTGAGGGGGGATGTTAAGCAAGCTGACCAAGATTACCAAAAGGAAAGTCATCAACGGTCAAGTCAACAAAGGGTTTATCACTCCACACAGCTTGCTCACGTCAAAGCTA
TTTGTCAAGGAATATCTCTAGCACGATTTTTACACTTGAATGCCAATATCATGTAGGAATATTTCATTCCTATTTTATAAAGATATTGTGCAATAGTTTAGGAAGTTACTTATTTTTCCT
TTAATATTATTAAGCCTTTCAACGGCTACTTTGTCTTTATTTTGTATAAATAACTCTGTAAATTTCATTAAAATTACAGAACAAGAATTATACTCTTCATAGAATTTCTTTCATTGTCTA
GGGTGTTACAGGTAAGGGGTTTGAACACAAGGTTACTTTTAGAACAAAGAGCCAAGTCTAAATATTCAGTCTTTTCATCAATGCTCAAGTCTTGTGTCCATTAAACTAGACAACACGNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTAGAGGTAACACCAATTAAAGTTTATGAGGAG
ATACTGTGCTAAGAAGGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACATAGAAGAGATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNA
AATCCGGAGTTATCACTACTTGATGTGCCAAGCATATATCTTAAGTGTTCAAAAGTTACTGTAGATTGTTGGGCACCTGCCTTTAAGCTTTCACTAATATTAAGTCAAATTGGTAGTTCA
GTATGATCCACAGCATATATATTTGACCTAAATGTCCCCTGCTCGAATATTTTCGAATACAAATTAAATATAATTTGCACATAATTGTATGAGTTGTTTGGATTTAATTCACGTGACATA
TCTAAAGAAGACTTGTGAAAAAGAATGAATGATATACCAAACTCAAAAATGATTTTTTAGTTTAATTCATGAGTCAAGACTAACATATTATAGTTTCATTTTTATTCTTTTTTGGATCAA
GTACTTATATATTCTCAGTTCAAGCAGCTTTAATCTTGCATTGCACGGCTAAAAGTATAGTATACTGTACACTAGTTTATGAATAAATAAAATGTATGTATCATTAATTTTACTATCATT
TTTTCCCTAAATTATTCATCATTTGGTAATTATAATTATTATAAACTTGATCTCCTTCTTTGTTATAGGGTTGTGATGCATCAGTGTTATTGGATGGAAGTGACAGTGAGAAGTTTGCCG
CGCCTAACCGGAACTCAGCACGAGGATTTGAAGTTATTGACGCAATAAAAACTGCCGTGGAAGATCAATGCAGTGGAGTTGTATCATGTGCTGATATTTTAGCCATAGCTGCAAGAGATT
CAGTGCTCTTG
GTAAGTTGGTTGATTAATTGTTCTTCTCATATAGATTCCATGGGACTAAAAGAAATAGAGACATGAGAAACTTGAGACCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTGTGTCTTAAAAGATAGAACTGTTGAACTAAATTATCAAGCAGGGACTAA
GTCATCTTAGTTCACAGGATTCTACCAATTAATAGATAAAGAATTTTTTTTTTCATATTCTAATGGTATGAGAAAATTAAAATTTTCTCTTTATATTTGAACTTTATGAGGTTAACTTTT
ACTTATACAAATACTATGACAATATTTTGCAGAGTGGAGGACCTACATGGAAAGTTCTGCTGGGAAGAAGAGATGGACTGGTGGCAAACCAGACAGGTGCCAATGCTCTTCCTTCACCGT
TTGAGGGGCTAAACATTCTCACTGCCAAGTTTGCAGCCGTGGGTCTAAATATTAAAGACCTAGTGTCCTTGTCAG
GTAATTTATTTGACCTCTCTATCACCATATATTTGTATCAACTCA
TAACTAATTAGCCTTCGTTCGGGATCACTTTAAATCGTAAAGTAATGACATTCTATATAAATTTGGCTCCTCTACTAGTTTAACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATTT
ATCTATCCGAAATTTTCTCAATGTTTGAAAAATATCCCAAAAGTTTGCATTAGGAATCCCAGGACCCCTTTTTGAACTCCCATAATGTGCGAGCTTGGTAATTTTAATGTTTATGTGCAG

GTGCTCATACAATTGGATTCGCAAAATGTGCCTTCTTCAGCAATAGACTATCCAACTTCTCAGGAACAGGTGCTCCAGACGCTACAATGGACACAAGCTTGGTGTCCGAATTGCAGAGCC
TATGTGCGAACGGGGACGGAAACAATACGACGCCGCTTGATCGGAACTCGATTGATCTATTTGACAACCATTACTTCCAGAACTTGATCAACAATAAGGGCCTTCTTAGTTCTGATCAAA
TTCTATACTCTAGTGATGAGGCCAAATCAACTACTGAGAGTCTTGTTGAAAGCTATAGCAGCAACTCAAATCTTTTCTTTGCTAATTTTGTTAATTCTATGATCAAAATGGGGAATGTAA
GTCCACTCACCGGGACTAATGGTGAGATTAGGAAGAACTGCAGGGCAGTTAATTCCTTAACTGAGATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTCTTCGTTATCTTATTGCAGCTGCTCTTGTAGTTGCATTTGTGCTTGAGGGATCATCACCAGCCCAAGCTCAACTTTCTCCCTTTTTTTATTCTTCCACATGCCCTAATGTA
ACCAACATAATTCGGGAGGTGCTTCAGAATGCTTTCTTGTCCGATATTCGTATCGGTGCCAGCCTCATCAGGCTTCATTTCCATGACTGTTTTGTTAAT
GGTTGTGATGCATCAGTGTTA
TTGGATGGAAGTGACAGTGAGAAGTTTGCCGCGCCTAACCGGAACTCAGCACGAGGATTTGAAGTTATTGACGCAATAAAAACTGCCGTGGAAGATCAATGCAGTGGAGTTGTATCATGT
GCTGATATTTTAGCCATAGCTGCAAGAGATTCAGTGCTCTTG
AGTGGAGGACCTACATGGAAAGTTCTGCTGGGAAGAAGAGATGGACTGGTGGCAAACCAGACAGGTGCCAATGCTCTT
CCTTCACCGTTTGAGGGGCTAAACATTCTCACTGCCAAGTTTGCAGCCGTGGGTCTAAATATTAAAGACCTAGTGTCCTTGTCAG
GTGCTCATACAATTGGATTCGCAAAATGTGCCTTC
TTCAGCAATAGACTATCCAACTTCTCAGGAACAGGTGCTCCAGACGCTACAATGGACACAAGCTTGGTGTCCGAATTGCAGAGCCTATGTGCGAACGGGGACGGAAACAATACGACGCCG
CTTGATCGGAACTCGATTGATCTATTTGACAACCATTACTTCCAGAACTTGATCAACAATAAGGGCCTTCTTAGTTCTGATCAAATTCTATACTCTAGTGATGAGGCCAAATCAACTACT
GAGAGTCTTGTTGAAAGCTATAGCAGCAACTCAAATCTTTTCTTTGCTAATTTTGTTAATTCTATGATCAAAATGGGGAATGTAAGTCCACTCACCGGGACTAATGGTGAGATTAGGAAG
AACTGCAGGGCAGTTAATTCCTTAACTGAGATATGA

Retrieve as FASTA